Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MPKGRAGSLPTTSIGWRFQLWFLGLTCPERHLARRLKNNSFYPFVQQEPNVFVLEYYLDTLWKGMLLFII      1 - 70
SVVLVSFSSLREVQKQETWVFLVYGVGVGLWLVISSLPRRRLVLNHTRGVYHFSIQGRTVCQGPLHLVYV     71 - 140
RLALSSDAHGRCFFHLVLGGHRLEPLVLVQLSEHYEQMEYLGRYIARKLNINYFDYLATSYRHVVRHWPP    141 - 210
PGAGTVMGKSPMGHKPSSSQSSLEV                                                 211 - 235
//

Text Mined References (2)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.