Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.14

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Gene RIF (1)

AA Sequence

MDEESLDGLLFKDHDFSSDLLRQLNSLRQSRILTDVSICAGAREIPCHRNVLASSSPYFRAMFCSSFREK      1 - 70
SEAKVQLKGIDPPTLDQIVSYVYTGEAHIATDNVLPVMEAASMLQFPKLFEACSSYLQSQLAPSNCLGMI     71 - 140
RLSEILSCETLKKKAREVALTSFPEVAASADLKELCALELRDYLGDDGLCGEEEKVFEALMVWIKHDLQA    141 - 210
RKRYMQELFKQVRLQYIHPAFFHHFIANDALLQSSPACQIILETAKRQMFSLCGTTVPDCKLLLHVPPRN    211 - 280
SYQDFLILLGGRKDSQQTTRDVLLYSKQTGQWQSLAKLPTRLYKASAITLHRSIYVLGGMAVSSGRSLVS    281 - 350
HNVYIFSLKLNQWRLGEPMLVARYSHRSTAHKNFIFSIGGIGEGQELMGSMERYDSICNVWESMASMPVG    351 - 420
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNSWFKMETRMIKNVCAPAVVLGERIVIVGGYTRR    421 - 490
ILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDSASFDCYDPETDTWTSQGQLP    491 - 560
HKLFDHACLTLQCIPRTSGLP                                                     561 - 581
//

Text Mined References (9)

PMID Year Title