Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDEESLDGLLFKDHDFSSDLLRQLNSLRQSRILTDVSICAGAREIPCHRNVLASSSPYFRAMFCSSFREK      1 - 70
SEAKVQLKGIDPPTLDQIVSYVYTGEAHIATDNVLPVMEAASMLQFPKLFEACSSYLQSQLAPSNCLGMI     71 - 140
RLSEILSCETLKKKAREVALTSFPEVAASADLKELCALELRDYLGDDGLCGEEEKVFEALMVWIKHDLQA    141 - 210
RKRYMQELFKQVRLQYIHPAFFHHFIANDALLQSSPACQIILETAKRQMFSLCGTTVPDCKLLLHVPPRN    211 - 280
SYQDFLILLGGRKDSQQTTRDVLLYSKQTGQWQSLAKLPTRLYKASAITLHRSIYVLGGMAVSSGRSLVS    281 - 350
HNVYIFSLKLNQWRLGEPMLVARYSHRSTAHKNFIFSIGGIGEGQELMGSMERYDSICNVWESMASMPVG    351 - 420
VLHPAVAVKDQRLYLFGGEDIMQNPVRLIQVYHISRNSWFKMETRMIKNVCAPAVVLGERIVIVGGYTRR    421 - 490
ILAYDPQSNKFVKCADMKDRRMHHGATVMGNKLYVTGGRRLTTDCNIEDSASFDCYDPETDTWTSQGQLP    491 - 560
HKLFDHACLTLQCIPRTSGLP                                                     561 - 581
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25055868 2014 Genome-wide association study of electrocardiographic parameters identifies a new association for PR interval and confirms previously reported associations.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23676014 2013 Update on the Kelch-like (KLHL) gene family.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.