Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.08
PubTator Score 9.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
DEAFNESS, AUTOSOMAL DOMINANT 4B 1 0.0 0.0
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 3.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.972 2.0

Expression

Gene RIF (4)

AA Sequence

MALTGYSWLLLSATFLNVGAEISITLEPAQPSEGDNVTLVVHGLSGELLAYSWYAGPTLSVSYLVASYIV      1 - 70
STGDETPGPAHTGREAVRPDGSLDIQGILPRHSGTYILQTFNRQLQTEVGYGHVQVHEILAQPTVLANST     71 - 140
ALVERRDTLRLMCSSPSPTAEVRWFFNGGALPVALRLGLSPDGRVLARHGIRREEAGAYQCEVWNPVSVS    141 - 210
RSEPINLTVYFGPERVAILQDSTTRTGCTIKVDFNTSLTLWCVSRSCPEPEYVWTFNGQALKNGQDHLNI    211 - 280
SSMTAAQEGTYTCIAKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW    281 - 350
YRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQ    351 - 420
VAPLG                                                                     421 - 425
//

Text Mined References (9)

PMID Year Title