Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.32
PubTator Score 1.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.235 0.001
cystic fibrosis 1.200 0.010
lung carcinoma 1.600 0.000
spina bifida -2.137 0.017
Breast cancer -1.700 0.001

Synonym

Accession Q2VYF4 A6NMG3 Q8NCR2 Q96LL1
Symbols

Gene

AA Sequence

MAFYSYNSVLAIARTRFPSHFVHPTCSSYSPSCAFLHLPDSHLNKTCMKNYESKKYSDPSQPGNTVLHPG      1 - 70
TRLIQKLHTSTCWLQEVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQSYRQKIMDELKYYYNGFYLL     71 - 140
WIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFE    141 - 210
SESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLF    211 - 280
EDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRAR    281 - 350
GMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFT    351 - 420
ESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKG    421 - 490
A//

Text Mined References (8)

PMID Year Title
18628306 2008 Characterization of the mitochondrial protein LETM1, which maintains the mitochondrial tubular shapes and interacts with the AAA-ATPase BCS1L.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11549311 2001 WHSC1L1, on human chromosome 8p11.2, closely resembles WHSC1 and maps to a duplicated region shared with 4p16.3.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.