Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.32
PubTator Score 1.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.700 6.4e-04
cystic fibrosis 1.200 1.0e-02
lung carcinoma 1.600 3.4e-20
osteosarcoma -1.235 1.1e-03
spina bifida -2.137 1.7e-02

AA Sequence

MAFYSYNSVLAIARTRFPSHFVHPTCSSYSPSCAFLHLPDSHLNKTCMKNYESKKYSDPSQPGNTVLHPG      1 - 70
TRLIQKLHTSTCWLQEVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQSYRQKIMDELKYYYNGFYLL     71 - 140
WIDAKVAARMVWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFE    141 - 210
SESKKEEKQKKKMAVKLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLF    211 - 280
EDQLALEHLDRPQLVALCKLLELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRAR    281 - 350
GMRSLGLTEEQLRQQLTEWQDLHLKENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFT    351 - 420
ESKENMVDLAPQLKGTKDEDFIQPPPVTSSPITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKG    421 - 490
A//

Text Mined References (8)

PMID Year Title