Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.42
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.897 0.000
tuberculosis and treatment for 6 months -1.100 0.000

Gene RIF (1)

PMID Text
16817023 This study reports the cloning and characterization of a novel human zinc finger protein cDNA (ZNF284L) from fetal brain cDNA library. The ZNF284L cDNA is 2223 bp in length encoding a 593-aa polypeptide.

AA Sequence

MTMFKEAVTFKDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQREEKFWIMET      1 - 70
ATQREGNSGGKIQTELESVPETGPHEEWSCQQIWEQTASELTRPQDSISSSQFSTQGDVPSQVDAGLSII     71 - 140
HIGETPSEHGKCKKFFSDVSILDLHQQLHSGKISHTCNEYRKRFCYSSALCLHQKVHMGEKRYKCDVCSK    141 - 210
AFSQNSQLQTHQRIHTGEKPFKCEQCGKSFSRRSGMYVHCKLHTGEKPHICEECGKAFIHNSQLREHQRI    211 - 280
HTGEKPFKCYICGKSFHSRSNLNRHSMVHMQEKSFRCDTCSNSFGQRSALNSHCMDHTKEKLYKCEECGR    281 - 350
SFTCRQDLCKHQMDHTGDKPYNCNVCGKGFRWSSCLSRHQRVHNGETTFKCDGCGKRFYMNSQGHSHQRA    351 - 420
YREEELYKCQKCGKGYISKFNLDLHQRVHTGERPYNCKECGKSFRWASGILRHKRLHTGEKPFKCEECGK    421 - 490
RFTENSKLRFHQRIHTGEKPYKCEECGKGFRWASTHLTHQRLHSREKLFQCEDCGKSSEHSSCLQDQQSD    491 - 560
HSGEKTSKCEDCGKRYERRLNLDMILSLFLNDI                                         561 - 593
//

Publication (2)

PMID Year Title
16817023 2006 Cloning and characterization of a novel KRAB-domain-containing zinc finger gene (ZNF284L).
12743021 2003 Differential expansion of zinc-finger transcription factor loci in homologous human and mouse gene clusters.