Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.42
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.18540829500507E-7
tuberculosis and treatment for 6 months 686 2.69118133002999E-5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.897 0.000
tuberculosis and treatment for 6 months -1.100 0.000

Synonym

Accession Q2VY69 Q86WM1
Symbols ZNF284L

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (1)

PMID Text
16817023 This study reports the cloning and characterization of a novel human zinc finger protein cDNA (ZNF284L) from fetal brain cDNA library. The ZNF284L cDNA is 2223 bp in length encoding a 593-aa polypeptide.

AA Sequence

MTMFKEAVTFKDVAVVFTEEELGLLDVSQRKLYRDVMLENFRNLLSVGHQLSHRDTFHFQREEKFWIMET      1 - 70
ATQREGNSGGKIQTELESVPETGPHEEWSCQQIWEQTASELTRPQDSISSSQFSTQGDVPSQVDAGLSII     71 - 140
HIGETPSEHGKCKKFFSDVSILDLHQQLHSGKISHTCNEYRKRFCYSSALCLHQKVHMGEKRYKCDVCSK    141 - 210
AFSQNSQLQTHQRIHTGEKPFKCEQCGKSFSRRSGMYVHCKLHTGEKPHICEECGKAFIHNSQLREHQRI    211 - 280
HTGEKPFKCYICGKSFHSRSNLNRHSMVHMQEKSFRCDTCSNSFGQRSALNSHCMDHTKEKLYKCEECGR    281 - 350
SFTCRQDLCKHQMDHTGDKPYNCNVCGKGFRWSSCLSRHQRVHNGETTFKCDGCGKRFYMNSQGHSHQRA    351 - 420
YREEELYKCQKCGKGYISKFNLDLHQRVHTGERPYNCKECGKSFRWASGILRHKRLHTGEKPFKCEECGK    421 - 490
RFTENSKLRFHQRIHTGEKPYKCEECGKGFRWASTHLTHQRLHSREKLFQCEDCGKSSEHSSCLQDQQSD    491 - 560
HSGEKTSKCEDCGKRYERRLNLDMILSLFLNDI                                         561 - 593
//

Text Mined References (2)

PMID Year Title
16817023 2006 Cloning and characterization of a novel KRAB-domain-containing zinc finger gene (ZNF284L).
12743021 2003 Differential expansion of zinc-finger transcription factor loci in homologous human and mouse gene clusters.