Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $28,021
PubMed Score 16.35
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.800 0.002
posterior fossa group A ependymoma 1.300 0.000
oligodendroglioma 1.200 0.009
osteosarcoma 1.547 0.028
group 3 medulloblastoma 3.000 0.000
cystic fibrosis 1.027 0.000
atypical teratoid / rhabdoid tumor 2.800 0.000
glioblastoma 1.300 0.006
medulloblastoma, large-cell 2.300 0.000
primitive neuroectodermal tumor 2.300 0.006
non-small cell lung cancer -1.142 0.000
pilocytic astrocytoma 1.100 0.000
subependymal giant cell astrocytoma 2.019 0.012
lung carcinoma -1.500 0.000
Breast cancer -1.100 0.000
ovarian cancer -1.200 0.000
pituitary cancer 1.300 0.027

Gene RIF (3)

PMID Text
24007463 PRTG is regulated by miRNA9, plays an inhibitory action on survival of chondroblasts and articular chondrocytes during chondrogenesis and osteoarthritis pathogenesis.
19076634 Identified association of attention deficit hyperactivity disorder (ADHD) to Protogenin (PRTG), a gene that potentially plays a role in cell migration and axon growth.
19076634 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPPLRPLARLRPPGMLLRALLLLLLLSPLPGVWCFSELSFVKEPQDVTVTRKDPVVLDCQAHGEVPIKV      1 - 70
TWLKNGAKMSENKRIEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMNKYGAILSQKAHLALSTISAFEVQ     71 - 140
PISTEVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMDRITALPTGVLQIYDVSQRDSGNYRCIAATV    141 - 210
AHRRKSMEASLTVIPAKESKSFHTPTIIAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFN    211 - 280
TRVLGNGNLMISDVRLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQA    281 - 350
EGIPSPKMSWLKNGRKIHSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPS    351 - 420
APYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDDLEPASNYT    421 - 490
FYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPIPAKYRRGQVVLYRLSFRLST    491 - 560
ENSIQVLELPGTTHEYLLEGLKPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKAPKSPELHLEPLN    561 - 630
CTTISVRWQQDVEDTAAIQGYKLYYKEEGQQENGPIFLDTKDLLYTLSGLDPRRKYHVRLLAYNNIDDGY    631 - 700
QADQTVSTPGCVSVRDRMVPPPPPPHHLYAKANTSSSIFLHWRRPAFTAAQIINYTIRCNPVGLQNASLV    701 - 770
LYLQTSETHMLVQGLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSW    771 - 840
KPPDGPETVVTRYTILYASRKAWIAGEWQVLHREGAITMALLENLVAGNVYIVKISASNEVGEGPFSNSV    841 - 910
ELAVLPKETSESNQRPKRLDSADAKVYSGYYHLDQKSMTGIAVGVGIALTCILICVLILIYRSKARKSSA    911 - 980
SKTAQNGTQQLPRTSASLASGNEVGKNLEGAVGNEESLMPMIMPNSFIDAKGGTDLIINSYGPIIKNNSK    981 - 1050
KKWFFFQDSKKIQVEQPQRRFTPAVCFYQPGTTVLISDEDSPSSPGQTTSFSRPFGVAADTEHSANSEGS   1051 - 1120
HETGDSGRFSHESNDEIHLSSVISTTPPNL                                           1121 - 1150
//

Publication (8)

PMID Year Title
24007463 2013 MicroRNA-9 regulates survival of chondroblasts and cartilage integrity by targeting protogenin.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22150322 2012 Nuclear translocation of intracellular domain of Protogenin by proteolytic cleavage.
19076634 2008 Association of ADHD and the Protogenin gene in the chromosome 15q21.3 reading disabilities linkage region.
15922677 2005 Identification of protogenin, a novel immunoglobulin superfamily gene expressed during early chick embryogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.