Property Summary

NCBI Gene PubMed Count 9
PubMed Score 16.49
PubTator Score 9.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.200 1.9e-02
Astrocytoma, Pilocytic 1.100 5.5e-04
atypical teratoid / rhabdoid tumor 2.400 1.6e-03
Breast cancer -1.100 6.0e-06
cystic fibrosis 1.027 2.4e-04
ependymoma 1.100 3.3e-02
glioblastoma 1.300 5.9e-03
group 3 medulloblastoma 3.000 2.5e-05
lung carcinoma -1.500 3.5e-10
medulloblastoma, large-cell 1.100 4.5e-04
non-small cell lung cancer -1.142 1.9e-15
oligodendroglioma 1.200 8.9e-03
osteosarcoma 1.547 2.8e-02
ovarian cancer -1.200 2.4e-06
pituitary cancer 1.300 2.7e-02
primitive neuroectodermal tumor 2.300 6.3e-03
subependymal giant cell astrocytoma 1.393 3.0e-02

Gene RIF (4)

AA Sequence

MAPPLRPLARLRPPGMLLRALLLLLLLSPLPGVWCFSELSFVKEPQDVTVTRKDPVVLDCQAHGEVPIKV      1 - 70
TWLKNGAKMSENKRIEVLSNGSLYISEVEGRRGEQSDEGFYQCLAMNKYGAILSQKAHLALSTISAFEVQ     71 - 140
PISTEVHEGGVARFACKISSHPPAVITWEFNRTTLPMTMDRITALPTGVLQIYDVSQRDSGNYRCIAATV    141 - 210
AHRRKSMEASLTVIPAKESKSFHTPTIIAGPQNITTSLHQTVVLECMATGNPKPIISWSRLDHKSIDVFN    211 - 280
TRVLGNGNLMISDVRLQHAGVYVCRATTPGTRNFTVAMATLTVLAPPSFVEWPESLTRPRAGTARFVCQA    281 - 350
EGIPSPKMSWLKNGRKIHSNGRIKMYNSKLVINQIIPEDDAIYQCMAENSQGSILSRARLTVVMSEDRPS    351 - 420
APYNVHAETMSSSAILLAWERPLYNSDKVIAYSVHYMKAEGLNNEEYQVVIGNDTTHYIIDDLEPASNYT    421 - 490
FYIVAYMPMGASQMSDHVTQNTLEDVPLRPPEISLTSRSPTDILISWLPIPAKYRRGQVVLYRLSFRLST    491 - 560
ENSIQVLELPGTTHEYLLEGLKPDSVYLVRITAATRVGLGESSVWTSHRTPKATSVKAPKSPELHLEPLN    561 - 630
CTTISVRWQQDVEDTAAIQGYKLYYKEEGQQENGPIFLDTKDLLYTLSGLDPRRKYHVRLLAYNNIDDGY    631 - 700
QADQTVSTPGCVSVRDRMVPPPPPPHHLYAKANTSSSIFLHWRRPAFTAAQIINYTIRCNPVGLQNASLV    701 - 770
LYLQTSETHMLVQGLEPNTKYEFAVRLHVDQLSSPWSPVVYHSTLPEAPAGPPVGVKVTLIEDDTALVSW    771 - 840
KPPDGPETVVTRYTILYASRKAWIAGEWQVLHREGAITMALLENLVAGNVYIVKISASNEVGEGPFSNSV    841 - 910
ELAVLPKETSESNQRPKRLDSADAKVYSGYYHLDQKSMTGIAVGVGIALTCILICVLILIYRSKARKSSA    911 - 980
SKTAQNGTQQLPRTSASLASGNEVGKNLEGAVGNEESLMPMIMPNSFIDAKGGTDLIINSYGPIIKNNSK    981 - 1050
KKWFFFQDSKKIQVEQPQRRFTPAVCFYQPGTTVLISDEDSPSSPGQTTSFSRPFGVAADTEHSANSEGS   1051 - 1120
HETGDSGRFSHESNDEIHLSSVISTTPPNL                                           1121 - 1150
//

Text Mined References (9)

PMID Year Title