Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.32
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Synonym

Accession Q2VWA4
Symbols CORL2
CH18515
FUSSEL18

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
20029986 Results verify IRX1, EBF3, SLC5A8, SEPT9, and FUSSEL18 as valid methylation markers in two separate sets of HNSCC specimens; also preliminarily show a trend between HPV16 positivity and target gene hypermethylation of IRX1, EBF3, SLC5A8, and SEPT9.
18522874 Experiments performed using mice, but the observations maybe relevant to other organisms as well.

AA Sequence

MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVSLVIDGQERLCLAQISNT      1 - 70
LLKNFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGENRPPKLP     71 - 140
DNFAFDVSHECAWGCRGSFIPARYNSSRAKCIKCSYCNMYFSPNKFIFHSHRTPDAKYTQPDAANFNSWR    141 - 210
RHLKLTDKSPQDELVFAWEDVKAMFNGGSRKRALPQPGAHPACHPLSSVKAAAVAAAAAVAGGGGLLGPH    211 - 280
LLGAPPPPPPPPPPLAELAGAPHAHHKRPRFDDDDDSLQEAAVVAAASLSAAAASLSVAAASGGAGTGGG    281 - 350
GAGGGCVAGVGVGAGAGAGAGAGAKGPRSYPVIPVPSKGSFGGVLQKFPGCGGLFPHPYTFPAAAAAFSL    351 - 420
CHKKEDAGAAAEALGGAGAGGAGAAPKAGLSGLFWPAGRKDAFYPPFCMFWPPRTPGGLPVPTYLQPPPQ    421 - 490
PPSALGCALGESPALLRQAFLDLAEPGGAAGSAEAAPPPGQPPQVVANGPGSGPPPPAGGAGSRDALFES    491 - 560
PPGGSGGDCSAGSTPPADSVAAAGAGAAAAGSGPAGSRVPAPHHPHLLEGRKAGGGSYHHSSAFRPVGGK    561 - 630
DDAESLAKLHGASAGAPHSAQTHPHHHHHPHHHHHHHHPPQPPSPLLLLPPQPDEPGSERHHPAPPPPPP    631 - 700
PPPPPPLAQHPHHRGLLSPGGTSCCYPSEDSSEDEDDEEEEQEVDVEGHKPPEGEEEEEGRDPDDDEEED    701 - 770
EETEVLLGDPLVGGGRFLQGRGPSEKGSSRDRAPAVAGAFPLGLNSSRLLQEDGKLGDPGSDLPPPPPPP    771 - 840
LAPQKASGGGSSSPGSPVHHPSLEEQPSYKDSQKTKENNQVIVSTKDDNSFSDKNKEHSFFITDSDASGG    841 - 910
DFWRERSGEHTQETNSPHSLKKDVENMGKEELQKVLFEQIDLRRRLEQEFQVLKGNTSFPVFNNFQDQMK    911 - 980
RELAYREEMVQQLQIVSCIST                                                     981 - 1001
//

Text Mined References (8)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20029986 2010 HPV status-independent association of alcohol and tobacco exposure or prior radiation therapy with promoter methylation of FUSSEL18, EBF3, IRX1, and SEPT9, but not SLC5A8, in head and neck squamous cell carcinomas.
18522874 2008 Identification of a novel transcriptional corepressor, Corl2, as a cerebellar Purkinje cell-selective marker.
16200078 2005 Cloning and functional characterization of a new Ski homolog, Fussel-18, specifically expressed in neuronal tissues.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15809229 2005 Comparative gene finding in chicken indicates that we are closing in on the set of multi-exonic widely expressed human genes.