Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.55

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGARLGRRAGPEAGSEAGAAAGCGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLERTLLPD      1 - 70
ILYRDVAFLNPVDPISHDLLVNLARDLQCPKKDYELWKSSDKICRQLIYHLTPHSKQQQGSSLRQRKTQS     71 - 140
CLKSSLQKTLLAGETVDLSGIPLSTQDVQHITRYLSSHGAVLAVLDLSFTGLSDELLHLLLPSLWALPRL    141 - 210
TQLLLNGNRLTRATARKLTDAIKDTTKFPALAWVDLGNNVDVASLPQPLLVGLRRRLSQRTSLPTIYEGL    211 - 280
DLEPEGSAAGATTPASTWDSTAAGLGPEPQACCAR                                       281 - 315
//

Text Mined References (5)

PMID Year Title
21909109 2011 Large-scale genome-wide association studies in East Asians identify new genetic loci influencing metabolic traits.
18940312 2008 Population-based genome-wide association studies reveal six loci influencing plasma levels of liver enzymes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.