Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.70
PubTator Score 1.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Basal cell carcinoma 29 3.062 1.5
Carcinoma 2,147 1.0

Expression

Gene RIF (4)

PMID Text
18684836 Disrupting the function of KIF4 leads Gag transient accumulation in discrete, perinuclear, nonendocytic clusters that co-localize with endogenous KIF4, Ubc9, and SUMO
18684836 Disrupting the function of KIF4 leads Gag transient accumulation in discrete, perinuclear, nonendocytic clusters that co-localize with endogenous KIF4, Ubc9, and SUMO
10559369 Disrupting the function of KIF4 leads Gag transient accumulation in discrete, perinuclear, nonendocytic clusters that co-localize with endogenous KIF4, Ubc9, and SUMO
10559369 Disrupting the function of KIF4 leads Gag transient accumulation in discrete, perinuclear, nonendocytic clusters that co-localize with endogenous KIF4, Ubc9, and SUMO

AA Sequence

MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGETQVVVGTDKSFTYDFVFDPCTEQEEVFNKAVA      1 - 70
PLIKGIFKGYNATVLAYGQTGSGKTYSMGGAYTAEQENEPTVGIIPRVIQLLFKEIDKKSDFEFTLKVSY     71 - 140
LEIYNEEILDLLCPSREKAQINIREDPKEGIKIVGLTEKTVLVALDTVSCLEQGNNSRTVASTAMNSQSS    141 - 210
RSHAIFTISIEQRKKSDKNCSFRSKLHLVDLAGSERQKKTKAEGDRLKEGININRGLLCLGNVISALGDD    211 - 280
KKGSFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLSTLRYADRARKIKNKPIVNIDPHTAE    281 - 350
LNHLKQQVQQLQVLLLQAHGGTLPGSINAEPSENLQSLMEKNQSLVEENEKLSRCLSKAAGQTAQMLERI    351 - 420
ILTEQVNEKLNAKLEELRQHVACKLDLQKLVETLEDQELKENVEIICNLQQLITQLSDETVACTAAAIDT    421 - 490
AVEEEAQVETSPETSRSSDAFTTQHALHQAQMSKEVVELNNALALKEALVRKMTQNDNQLQPIQFQYQDN    491 - 560
IKNLELEVINLQKEKEELVRELQTAKKNVNQAKLSEHRHKLLQELEGQIADLKKKLNEQSKLLKLKESTE    561 - 630
RTVSKLNQEIWMMKNQRVQLMRQMKEDAEKFRQWKQKKDKEVIQLKERDRKRQYELLKLERNFQKQSSVL    631 - 700
RRKTEEAAAANKRLKDALQKQREVTDKRKETQSHGKEGIAARVRNWLGNEIEVMVSTEEAKRHLNDLLED    701 - 770
RKILAQDVVQLKEKKESRENPPPKLRKCTFSLSEVHGQVLESEDCITKQIESLETEMELRSAQIADLQQK    771 - 840
LLDAESEDRPKQCWENIATILEAKCALKYLIGELVSSKIHVTKLENSLRQSKASCADMQKMLFEEQNHFS    841 - 910
EIETELQAELVRMEQQHQEKVLYLVSQLQESQMAEKQLEKSASEKEQQLVSTLQCQDEELEKMREVCEQN    911 - 980
QQLLQENEIIKQKLILLQVASRQKHLPNDTLLSPDSSFEYIPPKPKPSRVKEKFLEQSMDIEDLKYCSEH    981 - 1050
SVNEHEDGDGDGDSDEGDDEEWKPTKLVKVSRKNIQGCSCKGWCGNKQCGCRKQKSDCGVDCSCDPTKCR   1051 - 1120
NRQQGKDSLGTVEQTQDSEGSFKLEDPTEVTPGLSFFNPVCATPNSKILKEMCDMEQVLSKKTAPAPSPF   1121 - 1190
DLPESKHGATEYQQNKPPGKKKKRALASNTSFFSGCSPIEEEAH                             1191 - 1234
//

Text Mined References (6)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16201836 2005 Emergence of young human genes after a burst of retroposition in primates.
15843429 2005 Functional analysis of human microtubule-based motor proteins, the kinesins and dyneins, in mitosis/cytokinesis using RNA interference.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
10978527 2000 Identification of the human homologue of mouse KIF4, a kinesin superfamily motor protein.
10773663 2000 Assignment of the kinesin family member 4 genes (KIF4A and KIF4B) to human chromosome bands Xq13.1 and 5q33.1 by in situ hybridization.