Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
R01 Count 2
Funding $176,893.75
PubMed Score 2.69
PubTator Score 9.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -2.300 0.000
psoriasis -1.700 0.001
cutaneous lupus erythematosus -1.600 0.016
cystic fibrosis 4.263 0.000
atypical teratoid / rhabdoid tumor -1.500 0.009
non-small cell lung cancer 1.077 0.000
lung cancer 2.400 0.000
active Crohn's disease -1.002 0.039
active ulcerative colitis -1.078 0.032
lung adenocarcinoma 1.200 0.010
nasopharyngeal carcinoma 1.400 0.027
Breast cancer -2.700 0.000
breast carcinoma -1.100 0.000
invasive ductal carcinoma -1.300 0.011
ovarian cancer 1.300 0.001
chronic rhinosinusitis -1.023 0.020
severe asthma -1.100 0.000

Gene RIF (8)

PMID Text
26370503 Suggest alpha5beta1/Arp2/Arp3/FHOD3 pathway reprograms the actin cytoskeleton to promote invasive migration and local invasion in vivo.
24088304 DCM-associated FHOD3 variant may cause DCM by interfering with actin filament assembly.
23255317 FHOD variants is with hypertrophic cardiomyopathy.
23052206 C-terminal phosphorylation by ROCK1 is sufficient for FHOD3 activation as evidenced by an increase in F-actin in HeLa cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20195266 Clinical trial and genome-wide association study of gene-disease association. (HuGE Navigator)
19706596 actin dynamics regulated by Fhod3 are critical for sarcomere organization in striated muscle cells.
19066393 Single nucleotide polymorphism in FHOD3 gene is associated with acute lymphoblastic leukemia.

AA Sequence

MATLACRVQFLDDTDPFNSTNFPEPSRPPLFTFREDLALGTQLAGVHRLLQAPHKLDDCTLQLSHNGAYL      1 - 70
DLEATLAEQRDELEGFQDDAGRGKKHSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDL     71 - 140
VHEFVVAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINRNETIQWLYTLIGSKFRLVVKTA    141 - 210
LKLLLVFVEYSESNAPLLIQAVTAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQD    211 - 280
TFYDVVDCLEELGIAAVSQRHLNKKGTDLDLVEQLNIYEVALRHEDGDETTEPPPSGCRDRRRASVCSSG    281 - 350
GGEHRGLDRRRSRRHSVQSIKSTLSAPTSPCSQSAPSFKPNQVRDLREKYSNFGNNSYHSSRPSSGSSVP    351 - 420
TTPTSSVSPPQEARLERSSPSGLLTSSFRQHQESLAAERERRRQEREERLQRIEREERNKFRYKYLEQLA    421 - 490
AEEHEKELRSRSVSRGRADLSLDLTSPAAPACLAPLSHSPSSSDSQEALTVSASSPGTPHHPQASAGDPE    491 - 560
PESEAEPEAEAGAGQVADEAGQDIASAHEGAETEVEQALEQEPEERASLSEKERQNEGVNERDNCSASSV    561 - 630
SSSSSTLEREEKEDKLSRDRTTGLWPAGVQDAGVNGQCGDILTNKRFMLDMLYAHNRKSPDDEEKGDGEA    631 - 700
GRTQQEAEAVASLATRISTLQANSQTQDESVRRVDVGCLDNRGSVKAFAEKFNSGDLGRGSISPDAEPND    701 - 770
KVPETAPVQPKTESDYIWDQLMANPRELRIQDMDFTDLGEEDDIDVLDVDLGHREAPGPPPPPPPTFLGL    771 - 840
PPPPPPPLLDSIPPPPVPGNLLVPPPPVFNAPQGLGWSQVPRGQPTFTKKKKTIRLFWNEVRPFDWPCKN    841 - 910
NRRCREFLWSKLEPIKVDTSRLEHLFESKSKELSVSKKTAADGKRQEIIVLDSKRSNAINIGLTVLPPPR    911 - 980
TIKIAILNFDEYALNKEGIEKILTMIPTDEEKQKIQEAQLANPEIPLGSAEQFLLTLSSISELSARLHLW    981 - 1050
AFKMDYETTEKEVAEPLLDLKEGIDQLENNKTLGFILSTLLAIGNFLNGTNAKAFELSYLEKVPEVKDTV   1051 - 1120
HKQSLLHHVCTMVVENFPDSSDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPV   1121 - 1190
LKQRMSEFLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIREVNINKFCRIISEFALEYRTTRERV   1191 - 1260
LQQKQKRANHRERNKTRGKMITDSGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPA   1261 - 1330
LGVRTRSRASRGSTSSWTMGTDDSPNVTDDAADEIMDRIVKSATQVPSQRVVPRERKRSRANRKSLRRTL   1331 - 1400
KSGLTPEEARALGLVGTSELQL                                                   1401 - 1422
//

Text Mined References (21)

PMID Year Title
26370503 2015 ?5?1 integrin recycling promotes Arp2/3-independent cancer cell invasion via the formin FHOD3.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24088304 2013 Dilated cardiomyopathy-associated FHOD3 variant impairs the ability to induce activation of transcription factor serum response factor.
23255317 2013 Formin homology 2 domain containing 3 variants associated with hypertrophic cardiomyopathy.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23052206 2013 Two distinct phosphorylation events govern the function of muscle FHOD3.
21149568 2010 Formin follows function: a muscle-specific isoform of FHOD3 is regulated by CK2 phosphorylation and promotes myofibril maintenance.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
19706596 2009 Mammalian formin fhod3 regulates actin assembly and sarcomere organization in striated muscles.
More...