Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Amphetamine-Related Disorders 74
Disease Target Count P-value
psoriasis 6685 3.31546638515251E-33
posterior fossa group A ependymoma 1511 7.82712429801629E-14
adult high grade glioma 2148 0.00170885478896768
osteosarcoma 7933 0.00237983117256239
astrocytic glioma 2241 0.0139755699030114
facioscapulohumeral dystrophy 286 0.03644800060244
chronic rhinosinusitis 512 0.0434050978610557

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 0.014
osteosarcoma -3.286 0.002
posterior fossa group A ependymoma 4.100 0.000
adult high grade glioma 1.700 0.002
chronic rhinosinusitis -1.474 0.043
psoriasis -1.100 0.000
facioscapulohumeral dystrophy -1.700 0.036

Synonym

Accession Q2UY09 A4D101 A4D106 A4D107 A8MVR2 B9EGX9 Q2UY07 Q2UY08
Symbols COL28

Gene

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Dog OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (4)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
16330543 Collagen XXVIII is a novel von Willebrand factor A domain-containing protein with many imperfections in the collagenous domain

AA Sequence

MWNRYFVFYLLLLSAFTSQTVSGQRKKGPKSNLLARKSDVQGSICFIDIVFIVDSSESSKIALFDKQKDF      1 - 70
VDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQKVKSMNLIGQGTFSYYAISNA     71 - 140
TRLLKREGRKDGVKVVLLMTDGIDHPKNPDVQSISEDARISGISFITIALSTVVNEAKLRLISGDSSSEP    141 - 210
TLLLSDPTLVDKIQDRLDILFEKKCERKICECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNAQKGEAG    211 - 280
ERGPGGIPGYKGDKGERGECGKPGIKGDKGSPGPYGPKGPRGIQGITGPPGDPGPKGFQGNKGEPGPPGP    281 - 350
YGSPGAPGIGQQGIKGERGQEGRPGAPGPIGVGEPGQPGPRGPEGVPGERGLPGEGFPGPKGEKGSEGPT    351 - 420
GPQGLQGLSIKGEKGDIGPVGPQGPMGIPGIGSQGEQGIQGPIGPPGPQGPAGQGLPGSKGEVGQMGPTG    421 - 490
PRGPVGIGVQGPKGEPGSIGLPGQPGVPGEDGAAGKKGEAGLPGARGPEGPPGKGQPGPKGDEGKKGSKG    491 - 560
NQGQRGLPGPEGPKGEPGIMGPFGMPGTSIPGPPGPKGDRGGPGIPGFKGEPGLSIRGPKGVQGPRGPVG    561 - 630
APGLKGDGYPGVPGPRGLPGPPGPMGLRGVGDTGAKGEPGVRGPPGPSGPRGVGTQGPKGDTGQKGLPGP    631 - 700
PGPPGYGSQGIKGEQGPQGFPGPKGTMGHGLPGQKGEHGERGDVGKKGDKGEIGEPGSPGKQGLQGPKGD    701 - 770
LGLTKEEIIKLITEICGCGPKCKETPLELVFVIDSSESVGPENFQIIKNFVKTMADRVALDLATARIGII    771 - 840
NYSHKVEKVANLKQFSSKDDFKLAVDNMQYLGEGTYTATALQAANDMFEDARPGVKKVALVITDGQTDSR    841 - 910
DKEKLTEVVKNASDTNVEIFVIGVVKKNDPNFEIFHKEMNLIATDPEHVYQFDDFFTLQDTLKQKLFQKI    911 - 980
CEDFDSYLVQIFGSSSPQPGFGMSGEELSESTPEPQKEISESLSVTRDQDEDDKAPEPTWADDLPATTSS    981 - 1050
EATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQE   1051 - 1120
TCIQG                                                                    1121 - 1125
//

Text Mined References (10)

PMID Year Title
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16330543 2006 Collagen XXVIII, a novel von Willebrand factor A domain-containing protein with many imperfections in the collagenous domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.