Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.10
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Amphetamine-Related Disorders 74 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.3e-33
ependymoma 4679 2.4e-05
adult high grade glioma 3801 1.7e-03
osteosarcoma 7950 2.4e-03
astrocytic glioma 2597 1.4e-02
facioscapulohumeral dystrophy 288 3.6e-02
chronic rhinosinusitis 512 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.700 1.7e-03
astrocytic glioma 1.400 1.4e-02
chronic rhinosinusitis -1.474 4.3e-02
ependymoma 2.800 2.4e-05
facioscapulohumeral dystrophy -1.700 3.6e-02
osteosarcoma -3.286 2.4e-03
psoriasis -1.100 3.3e-33

Gene RIF (4)

AA Sequence

MWNRYFVFYLLLLSAFTSQTVSGQRKKGPKSNLLARKSDVQGSICFIDIVFIVDSSESSKIALFDKQKDF      1 - 70
VDSLSDKIFQLTPGRSLEYDIKLAALQFSSSVQIDPPFSSWKDLQTFKQKVKSMNLIGQGTFSYYAISNA     71 - 140
TRLLKREGRKDGVKVVLLMTDGIDHPKNPDVQSISEDARISGISFITIALSTVVNEAKLRLISGDSSSEP    141 - 210
TLLLSDPTLVDKIQDRLDILFEKKCERKICECEKGDPGDPGPPGTHGNPGIKGERGPKGNPGNAQKGEAG    211 - 280
ERGPGGIPGYKGDKGERGECGKPGIKGDKGSPGPYGPKGPRGIQGITGPPGDPGPKGFQGNKGEPGPPGP    281 - 350
YGSPGAPGIGQQGIKGERGQEGRPGAPGPIGVGEPGQPGPRGPEGVPGERGLPGEGFPGPKGEKGSEGPT    351 - 420
GPQGLQGLSIKGEKGDIGPVGPQGPMGIPGIGSQGEQGIQGPIGPPGPQGPAGQGLPGSKGEVGQMGPTG    421 - 490
PRGPVGIGVQGPKGEPGSIGLPGQPGVPGEDGAAGKKGEAGLPGARGPEGPPGKGQPGPKGDEGKKGSKG    491 - 560
NQGQRGLPGPEGPKGEPGIMGPFGMPGTSIPGPPGPKGDRGGPGIPGFKGEPGLSIRGPKGVQGPRGPVG    561 - 630
APGLKGDGYPGVPGPRGLPGPPGPMGLRGVGDTGAKGEPGVRGPPGPSGPRGVGTQGPKGDTGQKGLPGP    631 - 700
PGPPGYGSQGIKGEQGPQGFPGPKGTMGHGLPGQKGEHGERGDVGKKGDKGEIGEPGSPGKQGLQGPKGD    701 - 770
LGLTKEEIIKLITEICGCGPKCKETPLELVFVIDSSESVGPENFQIIKNFVKTMADRVALDLATARIGII    771 - 840
NYSHKVEKVANLKQFSSKDDFKLAVDNMQYLGEGTYTATALQAANDMFEDARPGVKKVALVITDGQTDSR    841 - 910
DKEKLTEVVKNASDTNVEIFVIGVVKKNDPNFEIFHKEMNLIATDPEHVYQFDDFFTLQDTLKQKLFQKI    911 - 980
CEDFDSYLVQIFGSSSPQPGFGMSGEELSESTPEPQKEISESLSVTRDQDEDDKAPEPTWADDLPATTSS    981 - 1050
EATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSCARFWFSGCNGSGNRFNSEKECQE   1051 - 1120
TCIQG                                                                    1121 - 1125
//

Text Mined References (11)

PMID Year Title