Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.29
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
Breast cancer 3099 1.33432959721024E-30
osteosarcoma 7933 1.79092496375447E-4
pancreatic cancer 2300 0.00115686152732745
lung cancer 4473 0.00145060136044271
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0064376003453004
colon cancer 1475 0.0218446147927136
psoriasis 6685 0.0443216172638115
gastric carcinoma 832 0.0489212430385033

Gene RIF (1)

PMID Text
26581719 The shortest intron sequence is 30 bp long and belongs to the MST1L gene of H. sapiens encoding for the putative macrophage stimulating 1-like protein.

AA Sequence

MAPAPVTLLAPGAASSMSCSQPGQRSPSNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRCGPLMD      1 - 70
CWAFHYNVSSHGCQLLPWTQHSPHSRLWHSGRCDLFQEKGEWGYMPTLRNGLEENFCRNPDGDPGGPWCH     71 - 140
TTDPAVRFQSCSIKSCRVAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDDNYC    141 - 210
RNPDGSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATSVSCFRGKGEGYRGTANTTTAAYLASVGTRK    211 - 280
SHISTDLRQKNTRASEVGGGAGVGTCCCGDLRENFCWNLDGSEAPWCFTLRPGTRVGFCYQIRRCTDDVR    281 - 350
PQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKLQALTLGRHALMSGTRAWKWLRLPCHDFAPAPASV    351 - 420
HIYLRTACTTGGELLPDPDGDSHGPWCYTMDPRTPFDYCALRRCDQVQFEKCGKRVDRLDQRRSKLRVAG    421 - 490
GHPGNSPWTVSLRNRQGQHFCAGSLVKEQWILTARQCFSSCHMPLTGYEVWLGTLFQNPQHGEPGLQRVP    491 - 560
VAKMLCGPSGSQLVLLKLERSVTLNQRVALICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNV    561 - 630
ISNQECNIKHRGHVRESEMCTEGLLAPVGACEGDYGGPLACFTHNCWVLKGIRIPNRVCTRSRWPAVFTR    631 - 700
VSVFVDWIHKVMRLG                                                           701 - 715
//

Text Mined References (5)

PMID Year Title
26581719 2015 Identification of minimal eukaryotic introns through GeneBase, a user-friendly tool for parsing the NCBI Gene databank.
22951037 2012 The GENCODE pseudogene resource.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
10728827 1998 Structure of the human D1F15S1A locus: a chromosome 1 locus with 97% identity to the chromosome 3 gene coding for hepatocyte growth factor-like protein.
10585770 1999 Multiple MSP pseudogenes in a local repeat cluster on 1p36.2: An expanding genomic graveyard?