Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
astrocytoma 1493 7.65446584924703E-22
ovarian cancer 8492 8.75305598238226E-10
glioblastoma 5572 5.3533511558009E-7
pilocytic astrocytoma 3086 9.05344952334613E-7
pediatric high grade glioma 2712 5.08925493192619E-6
sonic hedgehog group medulloblastoma 1482 5.75012507962432E-6
posterior fossa group B ependymoma 1530 7.62612320460613E-6
interstitial cystitis 2299 6.44399859636191E-5
osteosarcoma 7933 7.27794677014387E-5
primitive neuroectodermal tumor 3031 7.80008373261884E-4
pituitary cancer 1972 0.00146362289134539
subependymal giant cell astrocytoma 2287 0.00307107222988212
atypical teratoid / rhabdoid tumor 4369 0.00528485782752389
medulloblastoma, large-cell 6234 0.0132251398521841
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Keratosis 34 3.69 1.8

Expression

  Differential Expression (14)

Synonym

Accession Q2TBF2 B2RN48 B4DES1 Q8IY35 Q9Y4B7
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
18003638 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKLWFKFQRYFRRKPVRFFTFLALYLTAGSLVFLHSGFVGQPAVSGNQANPAAAGGPAEGAELSFLGDM      1 - 70
HLGRGFRDTGEASSIARRYGPWFKGKDGNERAKLGDYGGAWSRALKGRVVREKEEERAKYIGCYLDDTQS     71 - 140
RALRGVSFFDYKKMTIFRCQDNCAERGYLYGGLEFGAECYCGHKIQATNVSEAECDMECKGERGSVCGGA    141 - 210
NRLSVYRLQLAQESARRYGSAVFRGCFRRPDNLSLALPVTAAMLNMSVDKCVDFCTEKEYPLAALAGTAC    211 - 280
HCGFPTTRFPLHDREDEQLCAQKCSAEEFESCGTPSYFIVYQTQVQDNRCMDRRFLPGKSKQLIALASFP    281 - 350
GAGNTWARHLIELATGFYTGSYYFDGSLYNKGFKGERDHWRSGRTICIKTHESGQKEIEAFDAAILLIRN    351 - 420
PYKALMAEFNRKYGGHIGFAAHAHWKGKEWPEFVRNYAPWWATHTLDWLKFGKKVLVVHFEDLKQDLFVQ    421 - 490
LGRMVSLLGVAVREDRLLCVESQKDGNFKRSGLRKLEYDPYTADMQKTISAYIKMVDAALKGRNLTGVPD    491 - 560
DYYPR                                                                     561 - 565
//

Text Mined References (8)

PMID Year Title
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
22365631 2012 Genome-wide association study of temperament in bipolar disorder reveals significant associations with three novel Loci.
18003638 2008 High-density association study and nomination of susceptibility genes for hypertension in the Japanese National Project.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.