Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.80
PubTator Score 1.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q2TBC4 A2A3M0 A6PVU1 B3KQ15 Q5T3D4 Q9NSV1
Symbols OBTP
OEBT
TOMM6
C6orf49

Gene

  Ortholog (1)

Species Source
Horse OMA Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
15702247 molecular characterization of OEBT

AA Sequence

MSPQGPAVLSLGSLCLDTNQAPNWTGLQTLLQQLPPQDIDERYCLALGEEERAELQLFCARRKQEALGQG      1 - 70
VARLVLPKLEGHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCGRH     71 - 140
HAELLRPRCPACDQLIFSWRCTEAEGQRWHENHFCCQDCAGPLGGGRYALPGGSPCCPSCFENRYSDAGS    141 - 210
SWAGALEGQAFLGETGLDRTEGRDQTSVNSATLSRTLLAAAGGSSLQTQRGLPGSSPQQENRPGDKAEAP    211 - 280
KGQEQCRLETIRDPKDTPFSTCSSSSDSEPEGFFLGERLPQSWKTPGSLQAEDSNASKTHCTMC          281 - 344
//

Text Mined References (10)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15702247 2005 Characterization of OEBT, a LIM protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7923143 1994 Identification of genes overexpressed in tumors through preferential expression screening in trophoblasts.