Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.80
PubTator Score 3.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
NEMALINE MYOPATHY 8 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Nemaline myopathy 17 5.735 2.9
Disease Target Count Z-score Confidence
Congenital myopathy 16 4.221 2.1
locked-in syndrome 14 4.016 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.200 2.0e-03
psoriasis -1.200 6.1e-06
type II diabetes mellitus and post-ische... -1.100 3.3e-02

Gene RIF (3)

AA Sequence

MALGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRAGEREFPCHRLVLAACSPYFRARFLAEPERAG      1 - 70
ELHLEEVSPDVVAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTICVSFLQKRLCLSNCLAVFRLG     71 - 140
LLLDCARLAVAARDFICAHFTLVARDADFLGLSADELIAIISSDGLNVEKEEAVFEAVMRWAGSGDAEAQ    141 - 210
AERQRALPTVFESVRCRLLPRAFLESRVERHPLVRAQPELLRKVQMVKDAHEGRITTLRKKKKGKDGAGA    211 - 280
KEADKGTSKAKAEEDEEAERILPGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSNQVPKN    281 - 350
HVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGR    351 - 420
EIKDGERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEW    421 - 490
KELAPMQTARSLFGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPFEAFPQERSSLSLVSLVGTLY    491 - 560
AIGGFATLETESGELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRLNVLCLTKM             561 - 621
//

Text Mined References (10)

PMID Year Title