Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.04
PubTator Score 1.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 2.9e-06
ulcerative colitis 1819 5.9e-06
group 3 medulloblastoma 4104 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.947 2.0
Hailey-Hailey disease 6 3.453 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 2.0e-03
malignant mesothelioma 1.100 2.9e-06
ulcerative colitis -1.100 5.9e-06

Synonym

Accession Q2TB18 B4DFL9 Q3MIB6 Q8N6G4 Q96JY1 Q9UHX6
Symbols HT001

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 GO Process (1)

Gene RIF (2)

AA Sequence

MGIRGLMSFVEDHSNEFFTDLKLRDTKIVIDGYALFHRLCFSSNLDLRYGGDYDSFADVVQKFFESLFAC      1 - 70
NICPYVVLDGGCDISDKKLTTLKDRAREKIQMAHSLSVGGSGYVCPLLIREVFIQVLIKLRVCFVQCFSE     71 - 140
ADRDIMTLANHWNCPVLSSDSDFCIFDLKTGFCPLNSFQWRNMNTIKGTQNYIPAKCFSLDAFCHHFSNM    141 - 210
NKALLPLFAVLCGNDHVNLPIMETFLSKARLPLGATSSKGRRHHRILGLLNWLSHFANPTEALDNVLKYL    211 - 280
PKKDRENVKELLCCSMEEYQQSQVKLQDFFQCGTYVCPDALNLGLPEWVLVALAKGQLSPFISDALVLRR    281 - 350
TILPTQVENMQQPNAHRISQPIRQIIYGLLLNASPHLDKTSWNALPPQPLAFSEVERINKNIRTSIIDAV    351 - 420
ELAKDHSDLSRLTELSLRRRQMLLLETLKVKQTILEPIPTSLKLPIAVSCYWLQHTETKAKLHHLQSLLL    421 - 490
TMLVGPLIAIINSPGKEELQEDGAKMLYAEFQRVKAQTRLGTRLDLDTAHIFCQWQSCLQMGMYLNQLLS    491 - 560
TPLPEPDLTRLYSGSLVHGLCQQLLASTSVESLLSICPEAKQLYEYLFNATRSYAPAEIFLPKGRSNSKK    561 - 630
KRQKKQNTSCSKNRGRTTAHTKCWYEGNNRFGLLMVENLEEHSEASNIE                         631 - 679
//

Text Mined References (8)

PMID Year Title