Property Summary

NCBI Gene PubMed Count 15
PubMed Score 90.62
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 2.6e-04
glioblastoma -1.100 9.9e-03
group 3 medulloblastoma 1.100 4.2e-03
medulloblastoma, large-cell -1.300 3.0e-05
osteosarcoma -2.652 1.2e-09
ovarian cancer -1.300 1.8e-07
psoriasis 1.300 4.5e-04

Gene RIF (5)

AA Sequence

MSIEIESSDVIRLIMQYLKENSLHRALATLQEETTVSLNTVDSIESFVADINSGHWDTVLQAIQSLKLPD      1 - 70
KTLIDLYEQVVLELIELRELGAARSLLRQTDPMIMLKQTQPERYIHLENLLARSYFDPREAYPDGSSKEK     71 - 140
RRAAIAQALAGEVSVVPPSRLMALLGQALKWQQHQGLLPPGMTIDLFRGKAAVKDVEEEKFPTQLSRHIK    141 - 210
FGQKSHVECARFSPDGQYLVTGSVDGFIEVWNFTTGKIRKDLKYQAQDNFMMMDDAVLCMCFSRDTEMLA    211 - 280
TGAQDGKIKVWKIQSGQCLRRFERAHSKGVTCLSFSKDSSQILSASFDQTIRIHGLKSGKTLKEFRGHSS    281 - 350
FVNEATFTQDGHYIISASSDGTVKIWNMKTTECSNTFKSLGSTAGTDITVNSVILLPKNPEHFVVCNRSN    351 - 420
TVVIMNMQGQIVRSFSSGKREGGDFVCCALSPRGEWIYCVGEDFVLYCFSTVTGKLERTLTVHEKDVIGI    421 - 490
AHHPHQNLIATYSEDGLLKLWKP                                                   491 - 513
//

Text Mined References (21)

PMID Year Title