Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.800 2.1e-05
Astrocytoma, Pilocytic -2.000 1.4e-08
atypical teratoid / rhabdoid tumor -2.600 6.0e-09
glioblastoma -1.600 2.0e-07
group 4 medulloblastoma -1.100 2.2e-03
lung carcinoma 1.100 4.8e-23
medulloblastoma, large-cell -2.000 2.7e-04
primitive neuroectodermal tumor -1.600 6.1e-03

Synonym

Accession Q2TAP0 Q5T4F5
Symbols C10orf132
C10orf133
bA459F3.4
bA451M19.3

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

AA Sequence

MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQLFEETVKTLNGFYAEAEKIG      1 - 70
GSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYEDR     71 - 140
CSSGSSSSGSSSGSGSSSGGGGGAGAR                                               141 - 167
//

Text Mined References (6)

PMID Year Title