Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 4.77615110238013E-23
atypical teratoid / rhabdoid tumor 4369 5.97784913706061E-9
pilocytic astrocytoma 3086 7.49244607265127E-9
medulloblastoma 1524 3.27384179892279E-7
glioblastoma 5572 7.54553246152237E-6
adult high grade glioma 2148 2.11679225898481E-5
medulloblastoma, large-cell 6234 2.69718142107429E-4
primitive neuroectodermal tumor 3031 0.00606166126262408

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -2.000 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.600 0.006
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -2.000 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q2TAP0 Q5T4F5
Symbols C10orf132
C10orf133
bA459F3.4
bA451M19.3

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Zebrafish OMA Inparanoid

AA Sequence

MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQLFEETVKTLNGFYAEAEKIG      1 - 70
GSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYEDR     71 - 140
CSSGSSSSGSSSGSGSSSGGGGGAGAR                                               141 - 167
//

Text Mined References (6)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
17074475 2007 Chondrocyte secreted CRTAC1: a glycosylated extracellular matrix molecule of human articular cartilage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.