Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -2.000 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.600 0.006
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -2.000 0.000
lung carcinoma 1.100 0.000

Synonym

Accession Q2TAP0 Q5T4F5
Symbols C10orf132
C10orf133
bA459F3.4
bA451M19.3

Gene

AA Sequence

MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQLFEETVKTLNGFYAEAEKIG      1 - 70
GSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLLLTDPVERGMRVIEISIYEDR     71 - 140
CSSGSSSSGSSSGSGSSSGGGGGAGAR                                               141 - 167
//

Text Mined References (6)

PMID Year Title
24954895 2014 Gene-age interactions in blood pressure regulation: a large-scale investigation with the CHARGE, Global BPgen, and ICBP Consortia.
17074475 2007 Chondrocyte secreted CRTAC1: a glycosylated extracellular matrix molecule of human articular cartilage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.