Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.62
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.800 1.9e-04
atypical teratoid / rhabdoid tumor -1.600 3.6e-04
ependymoma -1.500 8.1e-08
glioblastoma -1.500 7.1e-08
group 3 medulloblastoma -1.200 3.4e-02
medulloblastoma, large-cell -2.200 2.1e-04
primitive neuroectodermal tumor -1.800 1.3e-04

AA Sequence

MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEG      1 - 70
GSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPE     71 - 140
PPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQ    141 - 210
CKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCF    211 - 280
AETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM                             281 - 325
//

Text Mined References (8)

PMID Year Title