Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.62
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 8.40258636568302E-9
medulloblastoma 1524 1.07737354817881E-8
primitive neuroectodermal tumor 3031 1.30839229966266E-4
adult high grade glioma 2148 1.93660501014303E-4
medulloblastoma, large-cell 6234 2.08128013445538E-4
glioblastoma 5572 3.07722507475777E-4
atypical teratoid / rhabdoid tumor 4369 3.61573428405848E-4
Disease Target Count Z-score Confidence
Holoprosencephaly 52 3.435 1.7

Expression

  Differential Expression (7)

Synonym

Accession Q2TAL6 Q6UXE2
Symbols UNQ739
PSST739

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid

AA Sequence

MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEG      1 - 70
GSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPE     71 - 140
PPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQ    141 - 210
CKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCF    211 - 280
AETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM                             281 - 325
//

Text Mined References (8)

PMID Year Title
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
17483092 2007 von Willebrand factor type C domain-containing proteins regulate bone morphogenetic protein signaling through different recognition mechanisms.
17400546 2007 Brorin, a novel secreted bone morphogenetic protein antagonist, promotes neurogenesis in mouse neural precursor cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.