Property Summary

NCBI Gene PubMed Count 9
PubMed Score 19.63
PubTator Score 9.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q2TAA5 A5PLP3 B4DKW9 Q5TAN9 Q6DKI6 Q96FI7
Symbols GT8
CDG1P

Gene

Gene RIF (3)

PMID Text
25036826 Hence, we concluded that there is different transcriptional control mechanism between mALG11 and hALG11
22213132 After identifying the congenital disorders of glycosylation-Ip index patient, study describe three more cases suffering from an ALG11 deficiency.
20080937 Deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation.

AA Sequence

MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGKNQMVIAFFHP      1 - 70
YCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRFNIRLIHPVQFVFLRKRYLVE     71 - 140
DSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAFTLPLFKYIGGCQVGSYVHYPTISTDMLSVV    141 - 210
KNQNIGFNNAAFITRNPFLSKVKLIYYYLFAFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYP    211 - 280
PCDVQTFLDIPLHEKKMTPGHLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDD    281 - 350
ELRVNQLRRLSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG    351 - 420
GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFEVTFLSSVEKL    421 - 490
FK                                                                        491 - 492
//

Text Mined References (11)

PMID Year Title
25036826 2014 Cloning and transcriptional expression of mouse mannosyltransferase IV/V cDNA, which is involved in the synthesis of lipid-linked oligosaccharides.
22213132 2012 Improved diagnostics lead to identification of three new patients with congenital disorder of glycosylation-Ip.
20080937 2010 A severe human metabolic disease caused by deficiency of the endoplasmatic mannosyltransferase hALG11 leads to congenital disorder of glycosylation-Ip.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16354793 2006 UTP14c is a recently acquired retrogene associated with spermatogenesis and fertility in man.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...