Property Summary

NCBI Gene PubMed Count 9
PubMed Score 20.30
PubTator Score 9.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE Ip 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 0.0 4.0
Disease Target Count Z-score Confidence
Meningoencephalitis 13 3.248 1.6
Rubella 15 3.152 1.6

Expression

Gene RIF (3)

AA Sequence

MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGKNQMVIAFFHP      1 - 70
YCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRFNIRLIHPVQFVFLRKRYLVE     71 - 140
DSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAFTLPLFKYIGGCQVGSYVHYPTISTDMLSVV    141 - 210
KNQNIGFNNAAFITRNPFLSKVKLIYYYLFAFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYP    211 - 280
PCDVQTFLDIPLHEKKMTPGHLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVLIGGCRNKDD    281 - 350
ELRVNQLRRLSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG    351 - 420
GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFEVTFLSSVEKL    421 - 490
FK                                                                        491 - 492
//

Text Mined References (11)

PMID Year Title