Property Summary

NCBI Gene PubMed Count 4
PubMed Score 7.08
PubTator Score 3.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
acute quadriplegic myopathy 1157 7.26937226389153E-7
ovarian cancer 8492 1.07516171425403E-5
atypical teratoid / rhabdoid tumor 4369 6.58641006731226E-4
primary pancreatic ductal adenocarcinoma 1271 0.00159352670917767
pancreatic cancer 2300 0.00470165419887194
Becker muscular dystrophy 187 0.00639392895995413

Expression

  Differential Expression (6)

Synonym

Accession Q2TAA2 B4DMV3
Symbols

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Pathway (1)

AA Sequence

MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLI      1 - 70
RKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETA     71 - 140
WEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFS    141 - 210
HLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH                                    211 - 248
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.