Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.8810079360815E-53
posterior fossa group A ependymoma 1511 3.84211692014019E-14
oligodendroglioma 2849 6.25031243170534E-11
pilocytic astrocytoma 3086 1.29907080466588E-7
glioblastoma 5572 3.74190200849152E-7
atypical teratoid / rhabdoid tumor 4369 1.31115805701328E-6
medulloblastoma, large-cell 6234 1.55234550449762E-5
adult high grade glioma 2148 1.77078511434202E-5
lung adenocarcinoma 2714 1.88157937526571E-5
sonic hedgehog group medulloblastoma 1482 9.96643388287928E-5
primitive neuroectodermal tumor 3031 4.73629036401729E-4
astrocytic glioma 2241 0.0256106359813374
subependymal giant cell astrocytoma 2287 0.0410968983456957

Expression

  Differential Expression (13)

Synonym

Accession Q2T9L4
Symbols INSYN1

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 Compartment GO Term (2)

AA Sequence

MNIRGAPDLGQPSDDPSSGGERERIRQRMKMVIGQLEGILRELKEVAKELREVVSQIDKLTSDFDFELEP      1 - 70
DDWTTATVSSTSSSDKAGMGGPFDLGHLDFMTADILSDSWEFCSFLDVSTPSDSVDGPESTRPGAGPDYR     71 - 140
LMNGGTPIPNGPRVETPDSSSEEAFGAGPTVKSQLPQRTPGTRERVRFSDKVLYHALCCDDEEGDGEQEV    141 - 210
EEEEVGLPPEPAHTEAHAGPHKPSPAPYKSRRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVL    211 - 280
PYTATRQKARGKN                                                             281 - 293
//

Text Mined References (3)

PMID Year Title
25048349 Open reading frames associated with cancer in the dark matter of the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.