Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.400 1.8e-05
astrocytic glioma -1.100 2.6e-02
Astrocytoma, Pilocytic -1.900 9.1e-08
atypical teratoid / rhabdoid tumor -1.500 3.8e-03
ependymoma -1.600 8.9e-03
glioblastoma -2.000 3.7e-07
group 4 medulloblastoma -1.700 4.5e-05
lung adenocarcinoma -1.400 1.9e-05
medulloblastoma, large-cell -1.600 7.7e-04
oligodendroglioma -1.100 6.3e-11
primitive neuroectodermal tumor -2.000 4.7e-04
psoriasis -1.600 2.9e-53
subependymal giant cell astrocytoma -1.377 4.1e-02

AA Sequence

MNIRGAPDLGQPSDDPSSGGERERIRQRMKMVIGQLEGILRELKEVAKELREVVSQIDKLTSDFDFELEP      1 - 70
DDWTTATVSSTSSSDKAGMGGPFDLGHLDFMTADILSDSWEFCSFLDVSTPSDSVDGPESTRPGAGPDYR     71 - 140
LMNGGTPIPNGPRVETPDSSSEEAFGAGPTVKSQLPQRTPGTRERVRFSDKVLYHALCCDDEEGDGEQEV    141 - 210
EEEEVGLPPEPAHTEAHAGPHKPSPAPYKSRRSPLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVL    211 - 280
PYTATRQKARGKN                                                             281 - 293
//

Text Mined References (4)

PMID Year Title