Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.53
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 2.1e-12
osteosarcoma 7950 6.5e-07
Disease Target Count Z-score Confidence
Zellweger syndrome 37 3.633 1.8
Tonsillitis 16 3.295 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.020 2.1e-12
osteosarcoma -1.639 6.5e-07

Gene RIF (5)

AA Sequence

MRRQWGSAMRAAEQAGCMVSASRAGQPEAGPWSCSGVILSRSPGLVLCHGGIFVPFLRAGSEVLTAAGAV      1 - 70
FLPGDSCRDDLRLHVQWAPTAAGPGGGAERGRPGLCTPQCASLEPGPPAPSRGRPLQPRLPAELLLLLSC     71 - 140
PAFWAHFARLFGDEAAEQWRFSSAARDDEVSEDEEADQLRALGWFALLGVRLGQEEVEEERGPAMAVSPL    141 - 210
GAVPKGAPLLVCGSPFGAFCPDIFLNTLSCGVLSNVAGPLLLTDARCLPGTEGGGVFTARPAGALVALVV    211 - 280
APLCWKAGEWVGFTLLCAAAPLFRAARDALHRLPHSTAALAALLPPEVGVPWGLPLRDSGPLWAAAAVLV    281 - 350
ECGTVWGSGVAVAPRLVVTCRHVSPREAARVLVRSTTPKSVAIWGRVVFATQETCPYDIAVVSLEEDLDD    351 - 420
VPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAVHSGSSGGPLFSNHS    421 - 490
GNLLGIITSNTRDNNTGATYPHLNFSIPITVLQPALQQYSQTQDLGGLRELDRAAEPVRVVWRLQRPLAE    491 - 560
APRSKL                                                                    561 - 566
//

Text Mined References (13)

PMID Year Title