Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.53
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.639 0.000
non-small cell lung cancer 1.020 0.000

Synonym

Accession Q2T9J0 Q5SQT4 Q5SQU1 Q8N6H2 Q96AR5
Symbols NET41

Gene

PANTHER Protein Class (3)

Gene RIF (6)

PMID Text
22190034 HIV-1 Pol is identified to have a physical interaction with trypsin domain containing 1 (TYSND1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Pol is identified to have a physical interaction with trypsin domain containing 1 (TYSND1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22002062 The proteolytic activity of oligomeric Tysnd1 is in turn controlled by self-cleavage of Tysnd1 and degradation of Tysnd1 cleavage products by PsLon.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17255948 characterization of protease function and self-cleavage of mouse Tysnd1
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRRQWGSAMRAAEQAGCMVSASRAGQPEAGPWSCSGVILSRSPGLVLCHGGIFVPFLRAGSEVLTAAGAV      1 - 70
FLPGDSCRDDLRLHVQWAPTAAGPGGGAERGRPGLCTPQCASLEPGPPAPSRGRPLQPRLPAELLLLLSC     71 - 140
PAFWAHFARLFGDEAAEQWRFSSAARDDEVSEDEEADQLRALGWFALLGVRLGQEEVEEERGPAMAVSPL    141 - 210
GAVPKGAPLLVCGSPFGAFCPDIFLNTLSCGVLSNVAGPLLLTDARCLPGTEGGGVFTARPAGALVALVV    211 - 280
APLCWKAGEWVGFTLLCAAAPLFRAARDALHRLPHSTAALAALLPPEVGVPWGLPLRDSGPLWAAAAVLV    281 - 350
ECGTVWGSGVAVAPRLVVTCRHVSPREAARVLVRSTTPKSVAIWGRVVFATQETCPYDIAVVSLEEDLDD    351 - 420
VPIPVPAEHFHEGEAVSVVGFGVFGQSCGPSVTSGILSAVVQVNGTPVMLQTTCAVHSGSSGGPLFSNHS    421 - 490
GNLLGIITSNTRDNNTGATYPHLNFSIPITVLQPALQQYSQTQDLGGLRELDRAAEPVRVVWRLQRPLAE    491 - 560
APRSKL                                                                    561 - 566
//

Text Mined References (13)

PMID Year Title
22002062 2011 Two proteases, trypsin domain-containing 1 (Tysnd1) and peroxisomal lon protease (PsLon), cooperatively regulate fatty acid ?-oxidation in peroxisomal matrix.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17255948 2007 Novel peroxisomal protease Tysnd1 processes PTS1- and PTS2-containing enzymes involved in beta-oxidation of fatty acids.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16128611 2005 Sequence-based discovery of the human and rodent peroxisomal proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
More...