Property Summary

NCBI Gene PubMed Count 7
Grant Count 6
Funding $907,472
PubMed Score 7.93
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q2QL34 B4DDY1 Q6P7T6 Q8N8E9
Symbols M-LPH
MLPH1
MLPH2
MPV17L1

Gene

Gene RIF (1)

PMID Text
26165189 these observations suggest that M-LPH is involved in the maintenance of mtDNA and protects cells from mitochondrial dysfunction.

AA Sequence

MAGWWPALSRAARRHPWPTNVLLYGSLVSAGDALQQRLQGREANWRQTRRVATLVVTFHANFNYVWLRLL      1 - 70
ERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFLDLKQKFWNTYLSGLMYWPFVQLTN     71 - 140
FSLVPVQWRTAYAGVCGFLWATFICFSQQSGDGTFKSAFTILYTKGTSATEGYPKK                  141 - 196
//

Text Mined References (8)

PMID Year Title
26165189 2015 Identification of interacting partners of Human Mpv17-like protein with a mitigating effect of mitochondrial dysfunction through mtDNA damage.
22306510 2012 Identification of Rhit as a novel transcriptional repressor of human Mpv17-like protein with a mitigating effect on mitochondrial dysfunction, and its transcriptional regulation by FOXD3 and GABP.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
16631601 2006 Human Mpv17-like protein is localized in peroxisomes and regulates expression of antioxidant enzymes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.