Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.44
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 5.46988965145488E-7
osteosarcoma 7933 3.65579102400523E-4
group 3 medulloblastoma 2254 4.22840487012286E-4
tuberculosis and treatment for 6 months 686 0.00798252511162243
oligodendroglioma 2849 0.0109057613531164
ependymoma 2514 0.0204183575224553
Disease Target Count Z-score Confidence
Moyamoya disease 9 4.057 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
ependymoma 1.200 0.020
oligodendroglioma 1.300 0.011
osteosarcoma 1.354 0.000
group 3 medulloblastoma 1.600 0.000
tuberculosis and treatment for 6 months 1.100 0.008

Synonym

Accession Q2QGD7 C5J0H9 Q6DKI8 Q7L3L1 Q8NAU2
Symbols ZXDL

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (6)

PMID Text
23954399 Data show that ZXDC1 is a regulator in the process of myeloid function and that ZXDC1 is responsible for Ccl2 gene de-repression by BCL6.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19777325 Role of ZXD proteins in regulating MHC II transcription.
17696781 study found sumoylation does not appear to disrupt or modulate interaction of ZXDC with binding partners; sumoylation of ZXDC is required for full activity of transcriptional activation domain; study suggests sumoylation is an important regulator of ZXDC
17493635 ZXDA and ZXDC form an important regulatory complex for MHC II gene transcription.
16600381 ZXDC is an important regulator of both MHC class I and class II transcription

AA Sequence

MDLPALLPAPTARGGQHGGGPGPLRRAPAPLGASPARRRLLLVRGPEDGGPGARPGEASGPSPPPAEDDS      1 - 70
DGDSFLVLLEVPHGGAAAEAAGSQEAEPGSRVNLASRPEQGPSGPAAPPGPGVAPAGAVTISSQDLLVRL     71 - 140
DRGVLALSAPPGPATAGAAAPRRAPQASGPSTPGYRCPEPQCALAFAKKHQLKVHLLTHGGGQGRRPFKC    141 - 210
PLEGCGWAFTTSYKLKRHLQSHDKLRPFGCPVGGCGKKFTTVYNLKAHMKGHEQESLFKCEVCAERFPTH    211 - 280
AKLSSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLR    281 - 350
SHTGERPFICDSDSCGWTFTSMSKLLRHRRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFEC    351 - 420
PVEGCCARFSARSSLYIHSKKHVQDVGAPKSRCPVSTCNRLFTSKHSMKAHMVRQHSRRQDLLPQLEAPS    421 - 490
SLTPSSELSSPGQSELTNMDLAALFSDTPANASGSAGGSDEALNSGILTIDVTSVSSSLGGNLPANNSSL    491 - 560
GPMEPLVLVAHSDIPPSLDSPLVLGTAATVLQQGSFSVDDVQTVSAGALGCLVALPMKNLSDDPLALTSN    561 - 630
SNLAAHITTPTSSSTPRENASVPELLAPIKVEPDSPSRPGAVGQQEGSHGLPQSTLPSPAEQHGAQDTEL    631 - 700
SAGTGNFYLESGGSARTDYRAIQLAKEKKQRGAGSNAGASQSTQRKIKEGKMSPPHFHASQNSWLCGSLV    701 - 770
VPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLPVYVLQEVLPSSGGPA    771 - 840
GPEATQFPGSTINLQDLQ                                                        841 - 858
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23954399 2013 The zinc finger transcription factor ZXDC activates CCL2 gene expression by opposing BCL6-mediated repression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19777325 2010 An N- and C-terminal truncated isoform of zinc finger X-linked duplicated C protein represses MHC class II transcription.
17696781 2007 Sumoylation of the zinc finger protein ZXDC enhances the function of its transcriptional activation domain.
17493635 2007 The zinc finger proteins ZXDA and ZXDC form a complex that binds CIITA and regulates MHC II gene transcription.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16600381 2007 ZXDC, a novel zinc finger protein that binds CIITA and activates MHC gene transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...