Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.10
PubTator Score 3.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Moyamoya disease 10 3.593 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.200 2.0e-02
group 3 medulloblastoma 1.600 4.2e-04
malignant mesothelioma 1.600 5.5e-07
oligodendroglioma 1.300 1.1e-02
osteosarcoma -1.194 2.7e-04
tuberculosis and treatment for 6 months 1.100 8.0e-03

Gene RIF (6)

AA Sequence

MDLPALLPAPTARGGQHGGGPGPLRRAPAPLGASPARRRLLLVRGPEDGGPGARPGEASGPSPPPAEDDS      1 - 70
DGDSFLVLLEVPHGGAAAEAAGSQEAEPGSRVNLASRPEQGPSGPAAPPGPGVAPAGAVTISSQDLLVRL     71 - 140
DRGVLALSAPPGPATAGAAAPRRAPQASGPSTPGYRCPEPQCALAFAKKHQLKVHLLTHGGGQGRRPFKC    141 - 210
PLEGCGWAFTTSYKLKRHLQSHDKLRPFGCPVGGCGKKFTTVYNLKAHMKGHEQESLFKCEVCAERFPTH    211 - 280
AKLSSHQRSHFEPERPYKCDFPGCEKTFITVSALFSHNRAHFREQELFSCSFPGCSKQYDKACRLKIHLR    281 - 350
SHTGERPFICDSDSCGWTFTSMSKLLRHRRKHDDDRRFTCPVEGCGKSFTRAEHLKGHSITHLGTKPFEC    351 - 420
PVEGCCARFSARSSLYIHSKKHVQDVGAPKSRCPVSTCNRLFTSKHSMKAHMVRQHSRRQDLLPQLEAPS    421 - 490
SLTPSSELSSPGQSELTNMDLAALFSDTPANASGSAGGSDEALNSGILTIDVTSVSSSLGGNLPANNSSL    491 - 560
GPMEPLVLVAHSDIPPSLDSPLVLGTAATVLQQGSFSVDDVQTVSAGALGCLVALPMKNLSDDPLALTSN    561 - 630
SNLAAHITTPTSSSTPRENASVPELLAPIKVEPDSPSRPGAVGQQEGSHGLPQSTLPSPAEQHGAQDTEL    631 - 700
SAGTGNFYLESGGSARTDYRAIQLAKEKKQRGAGSNAGASQSTQRKIKEGKMSPPHFHASQNSWLCGSLV    701 - 770
VPSGGRPGPAPAAGVQCGAQGVQVQLVQDDPSGEGVLPSARGPATFLPFLTVDLPVYVLQEVLPSSGGPA    771 - 840
GPEATQFPGSTINLQDLQ                                                        841 - 858
//

Text Mined References (17)

PMID Year Title