Property Summary

NCBI Gene PubMed Count 4
PubMed Score 106.37
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

AA Sequence

MASGCKIGPSILNSDLANLGAKCLQMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMH      1 - 70
MMVSKPEQWVKPMAVAEANQYTFHLEATENPGTLIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALV     71 - 140
MTVEPGFGEQKFMEDMMPKVHWLRTQFPSLDIEGDGGVGSDTVHKCAEAGANMTVSGSAIMRSEDPRSVI    141 - 210
NLLRNICSEAAQKRSLDR                                                        211 - 228
//

Text Mined References (6)

PMID Year Title