Property Summary

NCBI Gene PubMed Count 16
PubMed Score 20.96
PubTator Score 12.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung adenocarcinoma 2714 1.73399906318671E-10
posterior fossa group A ependymoma 1511 1.79392087884527E-7
atypical teratoid/rhabdoid tumor 1095 5.82758505152426E-4
primitive neuroectodermal tumor 3031 0.0120609729947208
osteosarcoma 7933 0.0196037824419007
sonic hedgehog group medulloblastoma 1482 0.0271138861148952
facioscapulohumeral dystrophy 286 0.0288611490525135
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 147 0.0 1.0
Disease Target Count Z-score Confidence
Mastoiditis 5 3.878 1.9
Cholesteatoma 13 3.466 1.7

Expression

Synonym

Accession Q2Q1W2
Symbols LIN41
LIN-41

Gene

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

 GWAS Trait (1)

Gene RIF (6)

PMID Text
26514622 Studies indicate most-studied TRIpartite Motif (TRIM)-NHL proteins TRIM2, TRIM3, TRIM32 and TRIM71, and their mutations have been linked to diseases.
24602972 Consistent with the let-7 microRNA stimulatory role of TRIM71 via Lin28B polyubiquitination.
23892092 poiopi poiopi i90iy9oyu8
23097274 The stem cell E3-ligase Lin-41 promotes liver cancer progression through inhibition of microRNA-mediated gene silencing.
22735451 Trim71 cooperates with microRNAs to repress Cdkn1a expression and promote embryonic stem cell proliferation
17890240 Repression of human TRIM71 and the zebrafish lin-41 ortholog was abolished when predicted let-7 target sites were mutated. Regulation of TRIM71 expression by let-7 seems to have been evolutionarily conserved.

AA Sequence

MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLPCLHAFCRPCL      1 - 70
EAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLLDAVVATADEPPPKNGRAGAP     71 - 140
AGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSAPGGPAASPSALLLRRPHGCSSCDEGNAASS    141 - 210
RCLDCQEHLCDNCVRAHQRVRLTKDHYIERGPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQH    211 - 280
HDDEVLHLYCDTCSVPICRECTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVA    281 - 350
EQVEMKAKVVQSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ    351 - 420
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKAT    421 - 490
GDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNGTYVVSYRPQLEGEH    491 - 560
LVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRI    561 - 630
QVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQF    631 - 700
NYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHR    701 - 770
LLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ    771 - 840
MDRPSGIAITPDGMIVVVDFGNNRILVF                                              841 - 868
//

Text Mined References (18)

PMID Year Title
26514622 2015 TRIM-NHL proteins in development and disease.
24602972 2014 The ubiquitin ligase human TRIM71 regulates let-7 microRNA biogenesis via modulation of Lin28B protein.
24393003 2014 The ability of TRIM3 to induce growth arrest depends on RING-dependent E3 ligase activity.
24239284 2014 The let-7/LIN-41 pathway regulates reprogramming to human induced pluripotent stem cells by controlling expression of prodifferentiation genes.
23892092 2013 Exploration of deleterious single nucleotide polymorphisms in the components of human P bodies: an in silico approach.
23512656 2013 LIN-41/TRIM71: emancipation of a miRNA target.
23125361 2013 The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function.
23097274 2013 The stem cell E3-ligase Lin-41 promotes liver cancer progression through inhibition of microRNA-mediated gene silencing.
22735451 2012 Trim71 cooperates with microRNAs to repress Cdkn1a expression and promote embryonic stem cell proliferation.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
More...