Property Summary

NCBI Gene PubMed Count 17
PubMed Score 23.04
PubTator Score 12.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.000 1.1e-02
ependymoma 1.100 2.0e-02
facioscapulohumeral dystrophy 1.700 2.9e-02
lung adenocarcinoma -1.900 1.7e-10
osteosarcoma -1.127 2.0e-02
primitive neuroectodermal tumor 2.100 1.2e-02
sonic hedgehog group medulloblastoma 1.400 2.7e-02

 GO Component (1)

Gene RIF (6)

AA Sequence

MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLPCLHAFCRPCL      1 - 70
EAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLLDAVVATADEPPPKNGRAGAP     71 - 140
AGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSAPGGPAASPSALLLRRPHGCSSCDEGNAASS    141 - 210
RCLDCQEHLCDNCVRAHQRVRLTKDHYIERGPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQH    211 - 280
HDDEVLHLYCDTCSVPICRECTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVA    281 - 350
EQVEMKAKVVQSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ    351 - 420
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKAT    421 - 490
GDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNGTYVVSYRPQLEGEH    491 - 560
LVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRI    561 - 630
QVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQF    631 - 700
NYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHR    701 - 770
LLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ    771 - 840
MDRPSGIAITPDGMIVVVDFGNNRILVF                                              841 - 868
//

Text Mined References (19)

PMID Year Title