Property Summary

NCBI Gene PubMed Count 16
Grant Count 28
R01 Count 25
Funding $3,737,310.16
PubMed Score 20.96
PubTator Score 12.74

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
26514622 Studies indicate most-studied TRIpartite Motif (TRIM)-NHL proteins TRIM2, TRIM3, TRIM32 and TRIM71, and their mutations have been linked to diseases.
24602972 Consistent with the let-7 microRNA stimulatory role of TRIM71 via Lin28B polyubiquitination.
23892092 poiopi poiopi i90iy9oyu8
23097274 The stem cell E3-ligase Lin-41 promotes liver cancer progression through inhibition of microRNA-mediated gene silencing.
22735451 Trim71 cooperates with microRNAs to repress Cdkn1a expression and promote embryonic stem cell proliferation
17890240 Repression of human TRIM71 and the zebrafish lin-41 ortholog was abolished when predicted let-7 target sites were mutated. Regulation of TRIM71 expression by let-7 seems to have been evolutionarily conserved.

AA Sequence

MASFPETDFQICLLCKEMCGSPAPLSSNSSASSSSSQTSTSSGGGGGGPGAAARRLHVLPCLHAFCRPCL      1 - 70
EAHRLPAAGGGAAGEPLKLRCPVCDQKVVLAEAAGMDALPSSAFLLSNLLDAVVATADEPPPKNGRAGAP     71 - 140
AGAGGHSNHRHHAHHAHPRASASAPPLPQAPQPPAPSRSAPGGPAASPSALLLRRPHGCSSCDEGNAASS    141 - 210
RCLDCQEHLCDNCVRAHQRVRLTKDHYIERGPPGPGAAAAAQQLGLGPPFPGPPFSILSVFPERLGFCQH    211 - 280
HDDEVLHLYCDTCSVPICRECTMGRHGGHSFIYLQEALQDSRALTIQLLADAQQGRQAIQLSIEQAQTVA    281 - 350
EQVEMKAKVVQSEVKAVTARHKKALEERECELLWKVEKIRQVKAKSLYLQVEKLRQNLNKLESTISAVQQ    351 - 420
VLEEGRALDILLARDRMLAQVQELKTVRSLLQPQEDDRVMFTPPDQALYLAIKSFGFVSSGAFAPLTKAT    421 - 490
GDGLKRALQGKVASFTVIGYDHDGEPRLSGGDLMSAVVLGPDGNLFGAEVSDQQNGTYVVSYRPQLEGEH    491 - 560
LVSVTLCNQHIENSPFKVVVKSGRSYVGIGLPGLSFGSEGDSDGKLCRPWGVSVDKEGYIIVADRSNNRI    561 - 630
QVFKPCGAFHHKFGTLGSRPGQFDRPAGVACDASRRIVVADKDNHRIQIFTFEGQFLLKFGEKGTKNGQF    631 - 700
NYPWDVAVNSEGKILVSDTRNHRIQLFGPDGVFLNKYGFEGALWKHFDSPRGVAFNHEGHLVVTDFNNHR    701 - 770
LLVIHPDCQSARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCKFGAQGSGFGQ    771 - 840
MDRPSGIAITPDGMIVVVDFGNNRILVF                                              841 - 868
//

Text Mined References (18)

PMID Year Title
26514622 2015 TRIM-NHL proteins in development and disease.
24602972 2014 The ubiquitin ligase human TRIM71 regulates let-7 microRNA biogenesis via modulation of Lin28B protein.
24393003 2014 The ability of TRIM3 to induce growth arrest depends on RING-dependent E3 ligase activity.
24239284 2014 The let-7/LIN-41 pathway regulates reprogramming to human induced pluripotent stem cells by controlling expression of prodifferentiation genes.
23892092 2013 Exploration of deleterious single nucleotide polymorphisms in the components of human P bodies: an in silico approach.
23512656 2013 LIN-41/TRIM71: emancipation of a miRNA target.
23125361 2013 The mammalian TRIM-NHL protein TRIM71/LIN-41 is a repressor of mRNA function.
23097274 2013 The stem cell E3-ligase Lin-41 promotes liver cancer progression through inhibition of microRNA-mediated gene silencing.
22735451 2012 Trim71 cooperates with microRNAs to repress Cdkn1a expression and promote embryonic stem cell proliferation.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
More...