Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.22
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
aldosterone-producing adenoma -1.261 1.5e-02
Breast cancer 2.500 4.2e-02
gastric carcinoma 1.200 3.0e-02
glioblastoma 1.800 7.4e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.5e-02
lung adenocarcinoma 1.100 7.0e-05
lung cancer 1.200 1.4e-02
lung carcinoma -1.400 4.0e-17
medulloblastoma, large-cell -1.700 2.3e-03
osteosarcoma -1.414 4.6e-03
ovarian cancer -2.400 2.3e-10
pancreatic cancer 1.400 1.5e-05
Pick disease -1.100 9.9e-04
primary pancreatic ductal adenocarcinoma 1.106 1.6e-02
primary Sjogren syndrome 1.100 2.1e-04
psoriasis -2.200 1.7e-05
ulcerative colitis 2.000 8.3e-10

Gene RIF (1)

AA Sequence

MEGRPPPEGRPPPRPRTGRAPRGRRRAVFAAVLHWSHITHLFENDRHFSHLSTLEREMAFRTEMGLYYSY      1 - 70
FKTIVEAPSFLNGVWMIMNDKLTEYPLVINTLKRFNLYPEVILASWYRIYTKIMDLIGIQTKICWTVTRG     71 - 140
EGLSPIESCEGLGDPACFYVAVIFILNGLMMALFFIYGTYLSGSRLGGLVTVLCFFFNHGECTRVMWTPP    141 - 210
LRESFSYPFLVLQMLLVTHILRATKLYRGSLIALCISNVFFMLPWQFAQFVLLTQIASLFAVYVVGYIDI    211 - 280
CKLRKIIYIHMISLALCFVLMFGNSMLLTSYYASSLVIIWGILAMKPHFLKINVSELSLWVIQGCFWLFG    281 - 350
TVILKYLTSKIFGIADDAHIGNLLTSKFFSYKDFDTLLYTCAAEFDFMEKETPLRYTKTLLLPVVLVVFV    351 - 420
AIVRKIISDMWGVLAKQQTHVRKHQFDHGELVYHALQLLAYTALGILIMRLKLFLTPHMCVMASLICSRQ    421 - 490
LFGWLFCKVHPGAIVFAILAAMSIQGSANLQTQWNIVGEFSNLPQEELIEWIKYSTKPDAVFAGAMPTMA    491 - 560
SVKLSALRPIVNHPHYEDAGLRARTKIVYSMYSRKAAEEVKRELIKLKVNYYILEESWCVRRSKPGCSMP    561 - 630
EIWDVEDPANAGKTPLCNLLVKDSKPHFTTVFQNSVYKVLEVVKE                             631 - 675
//

Text Mined References (8)

PMID Year Title