Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.22
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
psoriasis -2.200 0.000
osteosarcoma -1.414 0.005
glioblastoma 1.800 0.007
medulloblastoma, large-cell -1.700 0.002
primary pancreatic ductal adenocarcinoma 1.106 0.016
intraductal papillary-mucinous neoplasm ... 2.200 0.015
lung cancer 1.200 0.014
pancreatic cancer 1.400 0.000
Breast cancer 2.500 0.042
primary Sjogren syndrome 1.100 0.000
aldosterone-producing adenoma -1.261 0.015
lung adenocarcinoma 1.178 0.000
lung carcinoma -1.400 0.000
Pick disease -1.100 0.001
gastric carcinoma 1.200 0.030
ulcerative colitis 2.000 0.000
ovarian cancer -2.400 0.000

Synonym

Accession Q2PZI1 O94954 Q4G151
Symbols

Gene

Gene RIF (1)

PMID Text
22190034 HIV-1 Vpr is identified to have a physical interaction with dpy-19-like 1 (DPY19L1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MEGRPPPEGRPPPRPRTGRAPRGRRRAVFAAVLHWSHITHLFENDRHFSHLSTLEREMAFRTEMGLYYSY      1 - 70
FKTIVEAPSFLNGVWMIMNDKLTEYPLVINTLKRFNLYPEVILASWYRIYTKIMDLIGIQTKICWTVTRG     71 - 140
EGLSPIESCEGLGDPACFYVAVIFILNGLMMALFFIYGTYLSGSRLGGLVTVLCFFFNHGECTRVMWTPP    141 - 210
LRESFSYPFLVLQMLLVTHILRATKLYRGSLIALCISNVFFMLPWQFAQFVLLTQIASLFAVYVVGYIDI    211 - 280
CKLRKIIYIHMISLALCFVLMFGNSMLLTSYYASSLVIIWGILAMKPHFLKINVSELSLWVIQGCFWLFG    281 - 350
TVILKYLTSKIFGIADDAHIGNLLTSKFFSYKDFDTLLYTCAAEFDFMEKETPLRYTKTLLLPVVLVVFV    351 - 420
AIVRKIISDMWGVLAKQQTHVRKHQFDHGELVYHALQLLAYTALGILIMRLKLFLTPHMCVMASLICSRQ    421 - 490
LFGWLFCKVHPGAIVFAILAAMSIQGSANLQTQWNIVGEFSNLPQEELIEWIKYSTKPDAVFAGAMPTMA    491 - 560
SVKLSALRPIVNHPHYEDAGLRARTKIVYSMYSRKAAEEVKRELIKLKVNYYILEESWCVRRSKPGCSMP    561 - 630
EIWDVEDPANAGKTPLCNLLVKDSKPHFTTVFQNSVYKVLEVVKE                             631 - 675
//

Text Mined References (7)

PMID Year Title
22028030 2011 Dpy19l1, a multi-transmembrane protein, regulates the radial migration of glutamatergic neurons in the developing cerebral cortex.
19946888 2010 Defining the membrane proteome of NK cells.
16526957 2006 Duplication and relocation of the functional DPY19L2 gene within low copy repeats.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
10048485 1998 Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.