Property Summary

NCBI Gene PubMed Count 3
PubMed Score 21.39
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

AA Sequence

MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQQLRAALDELGRAKDREIATLQ      1 - 70
EQLMTSEATVHSLQATVHQRDELIRQLQPRAELLQDICRRRPPLAGLLDALAEAERLGPLPASDPGHPPP     71 - 140
GGPGPPLDNSTGEEADRDHLQPAVFGTTV                                             141 - 169
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14985129 2004 Vmac: a novel protein associated with vimentin-type intermediate filament in podocytes of rat kidney.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.