Property Summary

NCBI Gene PubMed Count 3
PubMed Score 22.39
PubTator Score 7.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession Q2NL98 B3KW55
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSAPPALQIREANAHLAAVHRRAAELEARLDAAERTVHAQAERLALHDQQLRAALDELGRAKDREIATLQ      1 - 70
EQLMTSEATVHSLQATVHQRDELIRQLQPRAELLQDICRRRPPLAGLLDALAEAERLGPLPASDPGHPPP     71 - 140
GGPGPPLDNSTGEEADRDHLQPAVFGTTV                                             141 - 169
//

Text Mined References (5)

PMID Year Title