Property Summary

NCBI Gene PubMed Count 8
PubMed Score 30.57
PubTator Score 11.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.81893763767218E-14
osteosarcoma 7933 3.75546162068801E-5
medulloblastoma, large-cell 6234 1.21294631345875E-4
ovarian cancer 8492 5.57935578088713E-4
oligodendroglioma 2849 6.69523913608669E-4
ependymoma 2514 9.991391219439E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00230592586685964
group 3 medulloblastoma 2254 0.00249431045486322
lung cancer 4473 0.00329864292558464
astrocytic glioma 2241 0.0134596079315049
Breast cancer 3099 0.039622019923429
Multiple myeloma 1328 0.0404292179362733

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma -1.056 0.040
astrocytic glioma 1.300 0.013
ependymoma 1.500 0.001
oligodendroglioma 1.400 0.001
osteosarcoma 1.355 0.000
medulloblastoma, large-cell 1.100 0.000
pancreatic ductal adenocarcinoma liver m... 1.722 0.002
non-small cell lung cancer 1.151 0.000
lung cancer 2.400 0.003
Breast cancer 2.400 0.040
group 3 medulloblastoma 1.700 0.002
ovarian cancer 1.200 0.001

Synonym

Accession Q2NL82 Q8WUY5 Q9NVT0 Q9P2E6
Symbols

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20805244 hTsr1 is involved downstream in nuclear export of the pre-40S particles.
19584346 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAHRPGPLKQQNKAHKGGRHRGRGSAQRDGKGRLALKTLSKKVRKELSRVDQRHRASQLRKQKKEAVLA      1 - 70
EKRQLGGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNFMLLCPRLKHRWFFTSARP     71 - 140
GDLHVVLDMAKVADTILFLLDPLEGWDSTGDYCLSCLFAQGLPTYTLAVQGISGLPLKKQIDTRKKLSKA    141 - 210
VEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDRRAYLFAHAVDFVPSEENNLVGTLKISGYVRG    211 - 280
QTLNVNRLLHIVGYGDFQMKQIDAPGDPFPLNPRGIKPQKDPDMAMEICATDAVDDMEEGLKVLMKADPG    281 - 350
RQESLQAEVIPDPMEGEQTWPTEEELSEAKDFLKESSKVVKKVPKGTSSYQAEWILDGGSQSGGEGDEYE    351 - 420
YDDMEHEDFMEEESQDESSEEEEEYETMTIGESVHDDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDT    421 - 490
PRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTL    491 - 560
HVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFS    561 - 630
QHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLS    631 - 700
GHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLY    701 - 770
KRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME                                        771 - 804
//

Text Mined References (10)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20805244 2011 Analysis of two human pre-ribosomal factors, bystin and hTsr1, highlights differences in evolution of ribosome biogenesis between yeast and mammals.
19584346 2009 Genetic variants associated with cardiac structure and function: a meta-analysis and replication of genome-wide association data.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.