Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.10
PubTator Score 11.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.300 1.3e-02
Breast cancer 2.400 4.0e-02
ependymoma 1.500 1.0e-03
group 3 medulloblastoma 1.700 2.5e-03
lung cancer 1.700 8.8e-03
medulloblastoma, large-cell 1.100 1.2e-04
Multiple myeloma -1.056 4.0e-02
non-small cell lung cancer 1.151 1.8e-14
oligodendroglioma 1.400 6.7e-04
osteosarcoma 1.355 3.8e-05
ovarian cancer -1.100 6.5e-04
pancreatic ductal adenocarcinoma liver m... 1.722 2.3e-03

Gene RIF (2)

AA Sequence

MAAHRPGPLKQQNKAHKGGRHRGRGSAQRDGKGRLALKTLSKKVRKELSRVDQRHRASQLRKQKKEAVLA      1 - 70
EKRQLGGKDGPPHQVLVVPLHSRISLPEAMQLLQDRDTGTVHLNELGNTQNFMLLCPRLKHRWFFTSARP     71 - 140
GDLHVVLDMAKVADTILFLLDPLEGWDSTGDYCLSCLFAQGLPTYTLAVQGISGLPLKKQIDTRKKLSKA    141 - 210
VEKRFPHDKLLLLDTQQEAGMLLRQLANQKQQHLAFRDRRAYLFAHAVDFVPSEENNLVGTLKISGYVRG    211 - 280
QTLNVNRLLHIVGYGDFQMKQIDAPGDPFPLNPRGIKPQKDPDMAMEICATDAVDDMEEGLKVLMKADPG    281 - 350
RQESLQAEVIPDPMEGEQTWPTEEELSEAKDFLKESSKVVKKVPKGTSSYQAEWILDGGSQSGGEGDEYE    351 - 420
YDDMEHEDFMEEESQDESSEEEEEYETMTIGESVHDDLYDKKVDEEAEAKMLEKYKQERLEEMFPDEVDT    421 - 490
PRDVAARIRFQKYRGLKSFRTSPWDPKENLPQDYARIFQFQNFTNTRKSIFKEVEEKEVEGAEVGWYVTL    491 - 560
HVSEVPVSVVECFRQGTPLIAFSLLPHEQKMSVLNMVVRRDPGNTEPVKAKEELIFHCGFRRFRASPLFS    561 - 630
QHTAADKHKLQRFLTADMALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRVVLS    631 - 700
GHPFKIFTKMAVVRYMFFNREDVLWFKPVELRTKWGRRGHIKEPLGTHGHMKCSFDGKLKSQDTVLMNLY    701 - 770
KRVFPKWTYDPYVPEPVPWLKSEISSTVPQGGME                                        771 - 804
//

Text Mined References (10)

PMID Year Title