Property Summary

Ligand Count 2
NCBI Gene PubMed Count 9
PubMed Score 4.76
PubTator Score 29.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia 1.100 2.3e-02
astrocytic glioma 1.800 2.9e-03
ependymoma 2.400 2.2e-03
group 3 medulloblastoma 1.200 4.7e-04
interstitial lung disease 1.300 2.5e-04
malignant mesothelioma 2.100 1.0e-07
oligodendroglioma 2.100 6.7e-04
osteosarcoma -1.072 2.1e-06
ovarian cancer -1.100 6.9e-06
Pick disease -1.200 3.6e-05
subependymal giant cell astrocytoma -1.080 1.5e-02

Synonym

Accession Q2NL67 Q9H7C5 Q9H9X6 Q9HAF3 Q9NPS6 Q9UFG4 PARP-6
Symbols ARTD17
pART17
PARP-6-C
PARP-6-B1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

 Compartment GO Term (1)

Gene RIF (4)

AA Sequence

MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREYGTIDDVDID      1 - 70
LHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQ     71 - 140
QWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLMN    141 - 210
RSISCTMKNPKVEVFGYPPSPQAGLLCPQHVGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIP    211 - 280
TLNEYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPR    281 - 350
KSIIFEPYPSVVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQW    351 - 420
IISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLVN    421 - 490
ASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRN    491 - 560
LNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN    561 - 630
//

Text Mined References (11)

PMID Year Title