Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.45
PubTator Score 29.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.300 0.000
malignant mesothelioma 2.100 0.000
astrocytic glioma 1.800 0.003
ependymoma 2.400 0.002
oligodendroglioma 2.100 0.001
osteosarcoma 1.708 0.000
group 3 medulloblastoma 1.300 0.001
subependymal giant cell astrocytoma -1.080 0.015
Pick disease -1.200 0.000
acute myeloid leukemia 1.100 0.023
ovarian cancer -2.500 0.000

Gene RIF (2)

PMID Text
23042038 PARP6, a mono(ADP-ribosyl) transferase and a negative regulator of cell proliferation, is involved in colorectal cancer development, PARP6-positive colorectal cancer had a good prognosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREYGTIDDVDID      1 - 70
LHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQ     71 - 140
QWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLMN    141 - 210
RSISCTMKNPKVEVFGYPPSPQAGLLCPQHVGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIP    211 - 280
TLNEYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPR    281 - 350
KSIIFEPYPSVVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQW    351 - 420
IISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLVN    421 - 490
ASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRN    491 - 560
LNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN    561 - 630
//

Text Mined References (9)

PMID Year Title
23042038 2012 PARP6, a mono(ADP-ribosyl) transferase and a negative regulator of cell proliferation, is involved in colorectal cancer development.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.