Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.45
PubTator Score 29.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.65638371485647E-19
malignant mesothelioma 3163 1.00149621384528E-7
Pick disease 1893 3.56870360092479E-5
osteosarcoma 7933 8.36535985892589E-5
interstitial lung disease 292 2.46061648518959E-4
oligodendroglioma 2849 6.69523913608669E-4
group 3 medulloblastoma 2254 7.21802851928609E-4
ependymoma 2514 0.00215711038643506
astrocytic glioma 2241 0.00286550299449665
subependymal giant cell astrocytoma 2287 0.0153399617978324
acute myeloid leukemia 785 0.0230254451185935

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial lung disease 1.300 0.000
malignant mesothelioma 2.100 0.000
astrocytic glioma 1.800 0.003
ependymoma 2.400 0.002
oligodendroglioma 2.100 0.001
osteosarcoma 1.708 0.000
group 3 medulloblastoma 1.300 0.001
subependymal giant cell astrocytoma -1.080 0.015
Pick disease -1.200 0.000
acute myeloid leukemia 1.100 0.023
ovarian cancer -2.500 0.000

Synonym

Accession Q2NL67 Q9H7C5 Q9H9X6 Q9HAF3 Q9NPS6 Q9UFG4 PARP-6
Symbols ARTD17
pART17
PARP-6-C
PARP-6-B1

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
23042038 PARP6, a mono(ADP-ribosyl) transferase and a negative regulator of cell proliferation, is involved in colorectal cancer development, PARP6-positive colorectal cancer had a good prognosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEIYSENSVSIREYGTIDDVDID      1 - 70
LHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPEPSIEVFQPSNKEGFGLGLQLKKILGMFTSQ     71 - 140
QWKHLSNDFLKTQQEKRHSWFKASGTIKKFRAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLMN    141 - 210
RSISCTMKNPKVEVFGYPPSPQAGLLCPQHVGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIP    211 - 280
TLNEYCVVCDEQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEEVATGAEVVDLLVAMCRAALESPR    281 - 350
KSIIFEPYPSVVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKLDPLAHPLLQW    351 - 420
IISSNRSHIVKLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENWHSILRNGLVN    421 - 490
ASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQSRN    491 - 560
LNCIALCEVITSKDLQKHGNIWVCPVSDHVCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN    561 - 630
//

Text Mined References (9)

PMID Year Title
23042038 2012 PARP6, a mono(ADP-ribosyl) transferase and a negative regulator of cell proliferation, is involved in colorectal cancer development.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.