Property Summary

NCBI Gene PubMed Count 20
Grant Count 14
R01 Count 8
Funding $12,958,937.67
PubMed Score 105.51
PubTator Score 21.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (11)

PMID Text
26643143 PICH and Topo II cooperate to prevent chromosome missegregation events in mitosis.
25564610 PICH is a SUMO-interacting protein and a mitotic SUMO substrate.
23973328 PICH recognizes and stabilizes DNA under tension during anaphase, thereby facilitating the resolution of entangled sister chromatids.
22563370 PICH protein was required for the correct recruitment to the centromere of active topoisomerase IIalpha, an enzyme specialized in the catenation/decatenation process.
21743438 PICH binds to BLM and enables BLM localization to anaphase centromeric threads. PICH and BLM unravel centromeric chromatin and keep anaphase DNA threads mostly free of nucleosomes.
20130082 the PICH-Plk1 complex plays a critical role in maintaining prometaphase chromosome architecture
19904549 the spindle checkpoint failure formerly attributed to the depletion of PICH most likely reflects an off-target effect that causes the lowering of Mad2 transcript and protein.
18418076 PICH phosphorylation and its ATPase activity are required for mitotic chromosome compaction through the targeting of Plk1 to chromosome arms.
17956945 The sensitivity to depletion of topo IIalpha might be linked to structural alterations within the centromere domain, indicated by shortening of the distance across metaphase sister centromeres and persistence of PICH-coated connections.
17218258 These data identify PICH as a novel essential component of checkpoint signaling.
More...

AA Sequence

MEASRRFPEAEALSPEQAAHYLRYVKEAKEATKNGDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEEL      1 - 70
AEQGDDEFTDVCNSGLLLYRELHNQLFEHQKEGIAFLYSLYRDGRKGGILADDMGLGKTVQIIAFLSGMF     71 - 140
DASLVNHVLLIMPTNLINTWVKEFIKWTPGMRVKTFHGPSKDERTRNLNRIQQRNGVIITTYQMLINNWQ    141 - 210
QLSSFRGQEFVWDYVILDEAHKIKTSSTKSAICARAIPASNRLLLTGTPIQNNLQELWSLFDFACQGSLL    211 - 280
GTLKTFKMEYENPITRAREKDATPGEKALGFKISENLMAIIKPYFLRRTKEDVQKKKSSNPEARLNEKNP    281 - 350
DVDAICEMPSLSRKNDLIIWIRLVPLQEEIYRKFVSLDHIKELLMETRSPLAELGVLKKLCDHPRLLSAR    351 - 420
ACCLLNLGTFSAQDGNEGEDSPDVDHIDQVTDDTLMEESGKMIFLMDLLKRLRDEGHQTLVFSQSRQILN    421 - 490
IIERLLKNRHFKTLRIDGTVTHLLEREKRINLFQQNKDYSVFLLTTQVGGVGLTLTAATRVVIFDPSWNP    491 - 560
ATDAQAVDRVYRIGQKENVVVYRLITCGTVEEKIYRRQVFKDSLIRQTTGEKKNPFRYFSKQELRELFTI    561 - 630
EDLQNSVTQLQLQSLHAAQRKSDIKLDEHIAYLQSLGIAGISDHDLMYTCDLSVKEELDVVEESHYIQQR    631 - 700
VQKAQFLVEFESQNKEFLMEQQRTRNEGAWLREPVFPSSTKKKCPKLNKPQPQPSPLLSTHHTQEEDISS    701 - 770
KMASVVIDDLPKEGEKQDLSSIKVNVTTLQDGKGTGSADSIATLPKGFGSVEELCTNSSLGMEKSFATKN    771 - 840
EAVQKETLQEGPKQEALQEDPLESFNYVLSKSTKADIGPNLDQLKDDEILRHCNPWPIISITNESQNAES    841 - 910
NVSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENS    911 - 980
LCGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGEDEDDSFKDTSSINPFNTSL    981 - 1050
FQFSSVKQFDASTPKNDISPPGRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEA   1051 - 1120
KGPEDYPEEGVEESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQ   1121 - 1190
DKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKSADPEVMLLTLSLYKQLNNN             1191 - 1250
//

Text Mined References (32)

PMID Year Title
26643143 2015 PICH promotes sister chromatid disjunction and co-operates with topoisomerase II in mitosis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25564610 2015 SUMOylation regulates polo-like kinase 1-interacting checkpoint helicase (PICH) during mitosis.
25416956 2014 A proteome-scale map of the human interactome network.
23973328 2013 PICH: a DNA translocase specially adapted for processing anaphase bridge DNA.
23275563 2013 Development and application of a DNA microarray-based yeast two-hybrid system.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22563370 2012 Bloom's syndrome and PICH helicases cooperate with topoisomerase II? in centromere disjunction before anaphase.
21743438 2011 PICH and BLM limit histone association with anaphase centromeric DNA threads and promote their resolution.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...