Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.37
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma 2.300 0.000
glioblastoma 1.200 0.001
atypical teratoid / rhabdoid tumor 1.100 0.000
lung cancer 1.100 0.025
subependymal giant cell astrocytoma 1.179 0.013
ovarian cancer 1.500 0.000

Synonym

Accession Q2MV58 A8MX11 Q49A60 Q6P5X1 Q6UXW2 Q8NAE9 Q96N72 Q9H798
Symbols TECT1
JBTS13

Gene

Gene RIF (5)

PMID Text
26844847 High TCTN1 expression is associated with Pancreatic Cancer.
26310786 These findings confirmed the direct association between the TCTN1 gene and prostate cancer growth in vitro.
25737023 These data suggest TCTN1 is essential for glioma cell viability, and dysregulation of TCTN1 may play a key role in glioma tumorigenesis.
25304031 TCTN1 may serve as a novel prognostic factor and a potential therapeutic target for glioblastoma.
21725307 Mutations in Tctn1 is associated with ciliopathies.

AA Sequence

MRPRGLPPLLVVLLGCWASVSAQTDATPAVTTEGLNSTEAALATFGTFPSTRPPGTPRAPGPSSGPRPTP      1 - 70
VTDVAVLCVCDLSPAQCDINCCCDPDCSSVDFSVFSACSVPVVTGDSQFCSQKAVIYSLNFTANPPQRVF     71 - 140
ELVDQINPSIFCIHITNYKPALSFINPEVPDENNFDTLMKTSDGFTLNAESYVSFTTKLDIPTAAKYEYG    141 - 210
VPLQTSDSFLRFPSSLTSSLCTDNNPAAFLVNQAVKCTRKINLEQCEEIEALSMAFYSSPEILRVPDSRK    211 - 280
KVPITVQSIVIQSLNKTLTRREDTDVLQPTLVNAGHFSLCVNVVLEVKYSLTYTDAGEVTKADLSFVLGT    281 - 350
VSSVVVPLQQKFEIHFLQENTQPVPLSGNPGYVVGLPLAAGFQPHKGSGIIQTTNRYGQLTILHSTTEQD    351 - 420
CLALEGVRTPVLFGYTMQSGCKLRLTGALPCQLVAQKVKSLLWGQGFPDYVAPFGNSQAQDMLDWVPIHF    421 - 490
ITQSFNRKDSCQLPGALVIEVKWTKYGSLLNPQAKIVNVTANLISSSFPEANSGNERTILISTAVTFVDV    491 - 560
SAPAEAGFRAPPAINARLPFNFFFPFV                                               561 - 587
//

Text Mined References (16)

PMID Year Title
26844847 2016 Tectonic 1 Is a Key Regulator of Cell Proliferation in Pancreatic Cancer.
26550235 2015 Lentivirus-Mediated knockdown of tectonic family member 1 inhibits medulloblastoma cell proliferation.
26540106 2015 Conserved Genetic Interactions between Ciliopathy Complexes Cooperatively Support Ciliogenesis and Ciliary Signaling.
26310786 2015 Tectonic?1 contributes to the growth and migration of prostate cancer cells in vitro.
26252641 2015 Tectonic 1 accelerates gastric cancer cell proliferation and cell cycle progression in vitro.
25737023 2015 Lentivirus-Mediated Knockdown of TCTN1 Inhibits Glioma Cell Proliferation.
25304031 2014 Expression and prognostic significance of TCTN1 in human glioblastoma.
22693042 2012 Molecular characterization of Joubert syndrome in Saudi Arabia.
21725307 2011 A transition zone complex regulates mammalian ciliogenesis and ciliary membrane composition.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...