Property Summary

NCBI Gene PubMed Count 48
Grant Count 73
R01 Count 20
Funding $5,027,714.83
PubMed Score 163.72
PubTator Score 100.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.595 0.000
breast carcinoma -1.400 0.005
lung adenocarcinoma -2.500 0.000
non-inflammatory breast cancer -2.200 0.000
ovarian cancer -3.200 0.000

Synonym

Accession Q2MKA7 A2A420 Q0H8S6 Q14C72 Q5T0F2 Q8N7L5
Symbols RSPO
CRISTIN3

Gene

PDB

4KT1   4QXF   4BSR   4BSS   4BST   4BSU   4KNG   4BSO   4BSP   4CDK   4LI2  

Gene RIF (22)

PMID Text
26485405 Genetic variants in ZC3H11B, RSPO1, and GJD2 are associated with susceptibility to the development of high myopia in a Han Chinese population.
26040030 Changes in the expression levels of IRS1, IRS2, RIPK2, RSPO1, and DNA JC15 genes might contribute to the development of insulin resistance and glucose intolerance in the obese boys.
25865226 R-Spondin1 has an effect on radiosensitivity of glioma cells
25480784 the LGR4-Rspo1 complex crystal structure shows divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors
25218283 overexpressed in fibrotic liver tissue
24639526 RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex.
24373193 Loss of RSPO1 expression is associated with invasive ductal carcinoma of the breast.
24349440 ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain.
24165923 ZNRF3 and LGR4-binding sites in RSPO1 are required for Wnt signaling.
23891289 Crystal structures of the Lgr4 ectodomain alone and bound to Rspo1.
More...

AA Sequence

MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIR      1 - 70
QVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTM     71 - 140
ECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQ    141 - 210
KRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA                     211 - 263
//

Text Mined References (48)

PMID Year Title
26485405 2016 Association between Ocular Axial Length-Related Genes and High Myopia in a Han Chinese Population.
26040030 2015 The expression of CCN2, IQSEC, RSPO1, DNAJC15, RIPK2, IL13RA2, IRS1, and IRS2 genes in blood of obese boys with insulin resistance.
25865226 2015 Silencing of R-Spondin1 increases radiosensitivity of glioma cells.
25480784 2015 Crystal structure of LGR4-Rspo1 complex: insights into the divergent mechanisms of ligand recognition by leucine-rich repeat G-protein-coupled receptors (LGRs).
25218283 2015 R-spondin1 arguments hepatic fibrogenesis in vivo and in vitro.
24639526 2014 RSPO-LGR4 functions via IQGAP1 to potentiate Wnt signaling.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24373193 2013 Prognostic significance of RSPO1, WNT1, P16, WT1, and SDC1 expressions in invasive ductal carcinoma of the breast.
24349440 2013 Structures of Wnt-antagonist ZNRF3 and its complex with R-spondin 1 and implications for signaling.
24165923 2013 Interaction with both ZNRF3 and LGR4 is required for the signalling activity of R-spondin.
More...