Property Summary

NCBI Gene PubMed Count 7
PubMed Score 4.69
PubTator Score 5.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.100 0.007
ovarian cancer -1.400 0.000

Synonym

Accession Q2MJR0 Q2MJR1 Spred-3
Symbols Eve-3
spred-3

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
16478641 Eve-3 may act as an inhibitor of proliferation pathways in the mature liver and be involved in modulating the unique regenerative capacity of this organ
12646235 The finding of Spred-3 revealed the presence of a novel family of regulators for the Ras/MAP kinase pathway, each member of which may have different specificities for extracellular signals. [Spred-3]

AA Sequence

MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGL      1 - 70
VYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPL     71 - 140
TSHVDSDSSSSHSRQETPPSAAAAPIITMESASGFGPTTPPQRRRSSAQSYPPLLPFTGIPEPSEPLAGA    141 - 210
GGLGWGGRGYEDYRRSGPPAPLALSTCVVRFAKTGALRGAALGPPAALPAPLTEAAPPAPPARPPPGPGP    211 - 280
SSAPAKASPEAEEAARCVHCRALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDF    281 - 350
SDPCACEPGHPRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAAR              351 - 410
//

Text Mined References (8)

PMID Year Title
19423641 2009 Sprouty proteins: modified modulators, matchmakers or missing links?
17094949 2006 Spred-2 steady-state levels are regulated by phosphorylation and Cbl-mediated ubiquitination.
16478641 2006 Eve-3: a liver enriched suppressor of Ras/MAPK signaling.
16465403 2006 FGF signaling inhibitor, SPRY4, is evolutionarily conserved target of WNT signaling pathway in progenitor cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14618415 2004 Mutation analysis of CBL-C and SPRED3 on 19q in human glioblastoma.
12646235 2003 Molecular cloning of mammalian Spred-3 which suppresses tyrosine kinase-mediated Erk activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.