Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.57
PubTator Score 3.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Gene RIF (2)

AA Sequence

MPVKCCFYRSPTAETMTWSENMDTLLANQAGLDAFRIFLKSEFSEENVEFWLACEDFKKTKNADKIASKA      1 - 70
KMIYSEFIEADAPKEINIDFGTRDLISKNIAEPTLKCFDEAQKLIYCLMAKDSFPRFLKSEIYKKLVNSQ     71 - 140
QVPNHKKWLPFL                                                              141 - 152
//

Text Mined References (4)

PMID Year Title