Property Summary

NCBI Gene PubMed Count 4
PubMed Score 3.57
PubTator Score 3.82

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
23095746 RGS21 modulates bitter taste signal transduction.
16302027 RGS21 mRNA is expressed ubiquitously in the 16 tissues examined, implying general physiological roles.

AA Sequence

MPVKCCFYRSPTAETMTWSENMDTLLANQAGLDAFRIFLKSEFSEENVEFWLACEDFKKTKNADKIASKA      1 - 70
KMIYSEFIEADAPKEINIDFGTRDLISKNIAEPTLKCFDEAQKLIYCLMAKDSFPRFLKSEIYKKLVNSQ     71 - 140
QVPNHKKWLPFL                                                              141 - 152
//

Text Mined References (4)

PMID Year Title
23095746 2012 Regulator of G-protein signaling-21 (RGS21) is an inhibitor of bitter gustatory signaling found in lingual and airway epithelia.
22763476 2012 Genome-wide linkage and association scans for pulse pressure in Chinese twins.
16302027 2005 Isolation and expression pattern of RGS21 gene, a novel RGS member.
15066150 2004 RGS21 is a novel regulator of G protein signalling selectively expressed in subpopulations of taste bud cells.