Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.54
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute myeloid leukemia 783 1.2e-02
Disease Target Count Z-score Confidence
Hypospadias 53 3.631 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.100 1.2e-02

AA Sequence

MPQVTFNDVAIDFTHEEWGWLSSAQRDLYKDVMVQNYENLVSVAGLSVTKPYVITLLEDGKEPWMMEKKL      1 - 70
SKGMIPDWESRWENKELSTKKDNYDEDSPQTVIIEKVVKQSYEFSNSKKNLEYIEKLEGKHGSQVDHFRP     71 - 140
AILTSRESPTADSVYKYNIFRSTFHSKSTLSEPQKISAEGNSHKYDILKKNLPKKSVIKNEKVNGGKKLL    141 - 210
NSNKSGAAFSQGKSLTLPQTCNREKIYTCSECGKAFGKQSILNRHWRIHTGEKPYECRECGKTFSHGSSL    211 - 280
TRHLISHSGEKPYKCIECGKAFSHVSSLTNHQSTHTGEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYE    281 - 350
CRICGKAFIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFL    351 - 420
VQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPYE    421 - 490
CIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHNGEKPNSVVSVEKPLDYMNHY    491 - 560
TCEKSYRRETV                                                               561 - 571
//

Text Mined References (6)

PMID Year Title