Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.54
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
acute myeloid leukemia 785 0.0115158401240804
Disease Target Count Z-score Confidence
Hypospadias 65 3.608 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.100 0.012

Synonym

Accession Q2M3W8 B7ZKX3 Q49A75
Symbols HHZ181

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid

AA Sequence

MPQVTFNDVAIDFTHEEWGWLSSAQRDLYKDVMVQNYENLVSVAGLSVTKPYVITLLEDGKEPWMMEKKL      1 - 70
SKGMIPDWESRWENKELSTKKDNYDEDSPQTVIIEKVVKQSYEFSNSKKNLEYIEKLEGKHGSQVDHFRP     71 - 140
AILTSRESPTADSVYKYNIFRSTFHSKSTLSEPQKISAEGNSHKYDILKKNLPKKSVIKNEKVNGGKKLL    141 - 210
NSNKSGAAFSQGKSLTLPQTCNREKIYTCSECGKAFGKQSILNRHWRIHTGEKPYECRECGKTFSHGSSL    211 - 280
TRHLISHSGEKPYKCIECGKAFSHVSSLTNHQSTHTGEKPYECMNCGKSFSRVSHLIEHLRIHTQEKLYE    281 - 350
CRICGKAFIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFL    351 - 420
VQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSICGKAFSHRSSLLQHHRIHTGEKPYE    421 - 490
CIKCGKTFSCSSNLTVHQRIHTGEKPYKCNECGKAFSKGSNLTAHQRVHNGEKPNSVVSVEKPLDYMNHY    491 - 560
TCEKSYRRETV                                                               561 - 571
//

Text Mined References (5)

PMID Year Title
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8914611 1996 Identification of a locus of zinc finger genes in human chromosome 19q13.1-q13.3 region by fluorescence in situ hybridization.