Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.11
PubTator Score 0.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 2.58947589109406E-30
atypical teratoid / rhabdoid tumor 4369 3.01910602884184E-12
glioblastoma 5572 3.0916135008779E-11
medulloblastoma 1524 6.95757044118285E-10
pediatric high grade glioma 2712 3.53551650984503E-8
medulloblastoma, large-cell 6234 2.95422896956556E-7
ovarian cancer 8492 4.39933338092011E-6
ulcerative colitis 2087 6.66624656885354E-6
primitive neuroectodermal tumor 3031 7.08971522281317E-5
interstitial cystitis 2299 9.75104922635045E-5
pilocytic astrocytoma 3086 2.52449552496558E-4
ependymoma 2514 6.54290377382042E-4
urothelial carcinoma 318 7.33618945582328E-4
cystic fibrosis 1670 9.55150912980986E-4
oligodendroglioma 2849 0.00346021228958872
subependymal giant cell astrocytoma 2287 0.00365675074053891
astrocytic glioma 2241 0.00381423505224255
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0452653824308588

Expression

  Differential Expression (18)

Disease log2 FC p
urothelial carcinoma -2.200 0.001
astrocytic glioma -3.300 0.004
ependymoma -4.200 0.001
oligodendroglioma -3.100 0.003
glioblastoma -4.900 0.000
medulloblastoma -5.400 0.000
atypical teratoid / rhabdoid tumor -5.300 0.000
medulloblastoma, large-cell -5.200 0.000
primitive neuroectodermal tumor -4.000 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.045
interstitial cystitis -2.700 0.000
cystic fibrosis -1.400 0.001
pediatric high grade glioma -3.800 0.000
pilocytic astrocytoma -2.300 0.000
subependymal giant cell astrocytoma -3.657 0.004
ulcerative colitis -2.500 0.000
ovarian cancer 1.400 0.000
psoriasis -1.400 0.000

Gene RIF (1)

PMID Text
18187620 Knockdown of sosondowah ankyrin repeat domain family member A (SOWAHA; ANKRD43) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQFVNNVAVVKE      1 - 70
LDGVKFVVLRKKPRPPEPEPAPFGPPGAAAQPSKPTSTVLPRSASAPGAPPLVRVPRPVEPPGDLGLPTE     71 - 140
PQDTPGGPASEPAQPPGERSADPPLPALELAQATERPSADAAPPPRAPSEAASPCSDPPDAEPGPGAAKG    141 - 210
PPQQKPCMLPVRCVPAPATLRLRAEEPGLRRQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRR    211 - 280
LSRAGPRLLSPDAEELPAAPPPSAVPLEPSEHEWLVRTAGGRWTHQLHGLLLRDRGLAAKRDFMSGFTAL    281 - 350
HWAAKSGDGEMALQLVEVARRSGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGR    351 - 420
RAYQYLRPGSSYALRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQ    421 - 490
DLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAGLVPSFPPTT               491 - 549
//

Text Mined References (6)

PMID Year Title
22234889 2012 An ancient genomic regulatory block conserved across bilaterians and its dismantling in tetrapods by retrogene replacement.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.