Property Summary

NCBI Gene PubMed Count 8
Grant Count 5
Funding $562,426
PubMed Score 5.09
PubTator Score 4.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 3.500 0.000
cutaneous lupus erythematosus 1.400 0.032

Gene RIF (3)

PMID Text
23086929 Identification of amino acid residues required for the substrate specificity of human and mouse chondroitin sulfate hydrolase (conventional hyaluronidase-4).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19889881 Identification of human hyaluronidase-4 as a novel chondroitin sulfate hydrolase that preferentially cleaves the galactosaminidic linkage in the trisulfated tetrasaccharide sequence

AA Sequence

MKVLSEGQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCLIKYNLRLNLK      1 - 70
MFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQVHLEKADQDINYYIPAEDFSG     71 - 140
LAVIDWEYWRPQWARNWNSKDVYRQKSRKLISDMGKNVSATDIEYLAKVTFEESAKAFMKETIKLGIKSR    141 - 210
PKGLWGYYLYPDCHNYNVYAPNYSGSCPEDEVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKF    211 - 280
RVHESMRISTMTSHDYALPVFVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTASKAN    281 - 350
CTKVKQFVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK    351 - 420
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQL             421 - 481
//

Text Mined References (13)

PMID Year Title
23086929 2012 Identification of amino acid residues required for the substrate specificity of human and mouse chondroitin sulfate hydrolase (conventional hyaluronidase-4).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19889881 2010 Identification of human hyaluronidase-4 as a novel chondroitin sulfate hydrolase that preferentially cleaves the galactosaminidic linkage in the trisulfated tetrasaccharide sequence.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
16104017 2005 Structures of vertebrate hyaluronidases and their unique enzymatic mechanism of hydrolysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10989127 2000 Human hyaluronidases: electrophoretic multiple forms in somatic tissues and body fluids. Evidence for conserved hyaluronidase potential N-glycosylation sites in different mammalian species.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10493834 1999 Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31.
9847074 1998 Toward a complete human genome sequence.