Property Summary

NCBI Gene PubMed Count 8
PubMed Score 5.09
PubTator Score 4.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.1e-06
cutaneous lupus erythematosus 1057 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Oxyphilic adenoma 22 3.491 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus 1.400 3.2e-02
psoriasis 1.500 3.1e-06

Gene RIF (3)

AA Sequence

MKVLSEGQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCLIKYNLRLNLK      1 - 70
MFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQVHLEKADQDINYYIPAEDFSG     71 - 140
LAVIDWEYWRPQWARNWNSKDVYRQKSRKLISDMGKNVSATDIEYLAKVTFEESAKAFMKETIKLGIKSR    141 - 210
PKGLWGYYLYPDCHNYNVYAPNYSGSCPEDEVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKF    211 - 280
RVHESMRISTMTSHDYALPVFVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTASKAN    281 - 350
CTKVKQFVSSDLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK    351 - 420
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQL             421 - 481
//

Text Mined References (13)

PMID Year Title