Property Summary

NCBI Gene PubMed Count 10
Grant Count 4
R01 Count 4
Funding $210,253.13
PubMed Score 0.85
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q2M3R5 Q86YG5 Q8NBA5
Symbols POST
TMEM20
C10orf60

Gene

PANTHER Protein Class (1)

AA Sequence

MRPQDSTGVAELQEPGLPLTDDAPPGATEEPAAAEAAGAPDRGRCWLCLSSPCCSRTEPEAKKKAPCPGL      1 - 70
GLFYTLLSAFLFSVGSLFVKKVQDVHAVEISAFRCVFQMLVVIPCLIYRKTGFIGPKGQRIFLILRGVLG     71 - 140
STAMMLIYYAYQTMSLADATVITFSSPVFTSIFAWICLKEKYSPWDALFTVFTITGVILIVRPPFLFGSD    141 - 210
TSGMEESYSGHLKGTFAAIGSAVFAASTLVILRKMGKSVDYFLSIWYYVVLGLVESVIILSVLGEWSLPY    211 - 280
CGLDRLFLIFIGLFGLGGQIFITKALQIEKAGPVAIMKTMDVVFAFIFQIIFFNNVPTWWTVGGALCVVA    281 - 350
SNVGAAIRKWYQSSK                                                           351 - 365
//

Text Mined References (10)

PMID Year Title
27028160 2016 Genome-wide Association Study of Cannabis Dependence Severity, Novel Risk Variants, and Shared Genetic Risks.
25775029 2015 Transcriptome comparisons identify new cell markers for theca interna and granulosa cells from small and large antral ovarian follicles.
22084111 2011 POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters.
21569384 2011 Functional specialization in nucleotide sugar transporters occurred through differentiation of the gene cluster EamA (DUF6) before the radiation of Viridiplantae.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.