Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.28
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRPQDSTGVAELQEPGLPLTDDAPPGATEEPAAAEAAGAPDRGRCWLCLSSPCCSRTEPEAKKKAPCPGL      1 - 70
GLFYTLLSAFLFSVGSLFVKKVQDVHAVEISAFRCVFQMLVVIPCLIYRKTGFIGPKGQRIFLILRGVLG     71 - 140
STAMMLIYYAYQTMSLADATVITFSSPVFTSIFAWICLKEKYSPWDALFTVFTITGVILIVRPPFLFGSD    141 - 210
TSGMEESYSGHLKGTFAAIGSAVFAASTLVILRKMGKSVDYFLSIWYYVVLGLVESVIILSVLGEWSLPY    211 - 280
CGLDRLFLIFIGLFGLGGQIFITKALQIEKAGPVAIMKTMDVVFAFIFQIIFFNNVPTWWTVGGALCVVA    281 - 350
SNVGAAIRKWYQSSK                                                           351 - 365
//

Text Mined References (10)

PMID Year Title