Property Summary

NCBI Gene PubMed Count 41
Grant Count 66
R01 Count 30
Funding $6,228,735.15
PubMed Score 124.15
PubTator Score 51.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.042 0.000
medulloblastoma, large-cell 1.100 0.000
non primary Sjogren syndrome sicca -1.100 0.016
ductal carcinoma in situ -1.400 0.013
invasive ductal carcinoma -1.900 0.007
ovarian cancer 1.200 0.000

Synonym

Accession Q2M3G0 A4D131 A7BKA4 B5MD19 B7WPL1 F8QQP8 F8QQP9 J3KQ04 Q2M3I5 Q5I5Q7 Q5I5Q8 Q6KG50 Q6XFQ5 Q8IXA1
Symbols ABCB5beta
EST422562
ABCB5alpha

Gene

Gene RIF (32)

PMID Text
26827764 ABCB5 has a role in chemoresistance in Merkel Cell Carcinoma
26666373 Results suggest that ATP binding cassette subfamily B member 5 ABCB5/Abcb5 upregulates cellular glutathione levels to protect cells from various poisons.
26554847 This is the first study showing the relationship between miR-340-5p and expression of ABCB5 in melanoma cells
26321644 ATP-binding cassette member B5 (ABCB5) identifies dermal immunoregulatory cells capable of exerting therapeutic immunoregulatory functions through engagement of programmed cell death 1.
25689483 c-MYC confers resistance to 5-fluorouracil through regulating ABCB5 expression in human colon cancer cells.
25647612 ABCB5 alleles alter susceptibility to haloperidol-induced toxicity (HIT) in mouse and humans.
25449786 The resistance of CD133(+) melanoma subpopulation is attributed to the enhanced drug efflux mediated by ATP-binding cassette sub-family B member 5 (ABCB5), since the knockdown of ABCB5 was found to sensitize CD133(+) cells to CAPE.
25030174 ATP-binding cassette, sub-family B, member 5 (ABCB5) marks limbal stem cells (LSCs) and is required for LSC maintenance, corneal development and repair
24934811 In melanoma-initiating cells, ABCB5 controls IL1beta secretion, which serves to maintain slow cycling, chemoresistant cells through an IL1beta/IL8/CXCR1 cytokine signaling circuit.
24804815 ABCB5 and MDR1 gene expression correlate with drug resistance in acute leukemia patients.
More...

AA Sequence

MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGACLPLMPLVLG      1 - 70
EMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIFGYIQISLWIITAARQTKRIR     71 - 140
KQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGDKIALLFQNMSTFSIGLAVGLVKGWKLTLVT    141 - 210
LSTSPLIMASAAACSRMVISLTSKELSAYSKAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFG    211 - 280
IKRTIASKVSLGAVYFFMNGTYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFA    281 - 350
IARGAAFHIFQVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV    351 - 420
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISNNIKYGRDDVT    421 - 490
DEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALVRNPKILILDEATSALDSESK    491 - 560
SAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADE    561 - 630
QMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASV    631 - 700
LNGTVHPVFSIIFAKIITMFGNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRH    701 - 770
LAFKAMLYQDIAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL    771 - 840
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMYEEMLQTQHRN    841 - 910
TSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTAIAYGAMAIGETLVLAPEYSK    911 - 980
AKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREVSFFYPCRPDVFILRGLSLSIERGKTVAFVG    981 - 1050
SSGCGKSTSVQLLQRLYDPVQGQVLFDGVDAKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVV   1051 - 1120
PLDEIKEAANAANIHSFIEGLPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDS   1121 - 1190
EKVVQHALDKARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ      1191 - 1257
//

Text Mined References (45)

PMID Year Title
26827764 2016 ABCB5-Targeted Chemoresistance Reversal Inhibits Merkel Cell Carcinoma Growth.
26666373 2015 Upregulation of cellular glutathione levels in human ABCB5- and murine Abcb5-transfected cells.
26554847 2015 Diminution of miR-340-5p levels is responsible for increased expression of ABCB5 in melanoma cells under oxygen-deprived conditions.
26321644 2015 ABCB5 Identifies Immunoregulatory Dermal Cells.
25689483 2015 The c-MYC-ABCB5 axis plays a pivotal role in 5-fluorouracil resistance in human colon cancer cells.
25647612 2015 The role of Abcb5 alleles in susceptibility to haloperidol-induced toxicity in mice and humans.
25449786 2015 CD133? melanoma subpopulation acquired resistance to caffeic acid phenethyl ester-induced apoptosis is attributed to the elevated expression of ABCB5: significance for melanoma treatment.
25030174 2014 ABCB5 is a limbal stem cell gene required for corneal development and repair.
24934811 2014 ABCB5 maintains melanoma-initiating cells through a proinflammatory cytokine signaling circuit.
24804815 2014 The clinical relevance and prognostic significance of adenosine triphosphate ATP-binding cassette (ABCB5) and multidrug resistance (MDR1) genes expression in acute leukemia: an Egyptian study.
More...