Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.44
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.4e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 3.643 1.8

Synonym

Accession Q2M3D2 Q8N9W2 Q96GV2
Symbols XTP7

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

Protein-protein Interaction (3)

Gene RIF (5)

AA Sequence

MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHT      1 - 70
ERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAER     71 - 140
LARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQAL    141 - 210
ALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWL    211 - 280
DAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGA    281 - 350
LSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR               351 - 409
//

Text Mined References (13)

PMID Year Title