Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.41
PubTator Score 5.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.692 0.000

Gene RIF (4)

PMID Text
23663385 This meta-analysis assesses an association between rs597668 polymorphism in EXOC3L2 and Alzheimer's disease.
22381399 This study suggests that the rs597668 polymorphism near EXOC3L2 may not play a major role in the susceptibility to late-onset Alzheimer's disease in the Northern Han Chinese population.
21566143 exoc3l2 silencing inhibits VEGF receptor 2 phosphorylation and VEGFA-directed migration of cultured endothelial cells.
20460622 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHT      1 - 70
ERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAER     71 - 140
LARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQAL    141 - 210
ALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWL    211 - 280
DAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGA    281 - 350
LSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR               351 - 409
//

Text Mined References (12)

PMID Year Title
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
23663385 2013 Association between EXOC3L2 rs597668 polymorphism and Alzheimer's disease.
22381399 2012 Lack of association between rs597668 polymorphism near EXOC3L2 and late-onset Alzheimer's disease in Han Chinese.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21566143 2011 Exocyst complex component 3-like 2 (EXOC3L2) associates with the exocyst complex and mediates directional migration of endothelial cells.
20460622 2010 Genome-wide analysis of genetic loci associated with Alzheimer disease.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...