Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.74
PubTator Score 29.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.400 2.3e-06
Alzheimer's disease -1.300 3.7e-02
astrocytoma -1.200 1.7e-05
Astrocytoma, Pilocytic -4.500 1.1e-11
atypical teratoid / rhabdoid tumor -4.200 1.6e-10
Breast cancer -1.800 2.6e-24
ependymoma -3.500 8.6e-11
glioblastoma -3.400 7.0e-09
group 3 medulloblastoma -4.700 4.7e-06
lung carcinoma 5.900 2.5e-60
medulloblastoma, large-cell -4.100 4.2e-05
non diabetic and post-ischemic heart fai... 1.100 1.3e-02
osteosarcoma 1.058 5.2e-03
Pick disease -1.700 2.4e-03
primitive neuroectodermal tumor -3.400 3.4e-03
subependymal giant cell astrocytoma -4.205 3.7e-03

Gene RIF (9)

AA Sequence

MDGNSLLSVPSNLESSRMYDVLEPQQGRGCGSSGSGPGNSITACKKVLRSNSLLESTDYWLQNQRMPCQI      1 - 70
GFVEDKSENCASVCFVNLDVNKDECSTEHLQQKLVNVSPDLPKLISSMNVQQPKENEIVVLSGLASGNLQ     71 - 140
ADFEVSQCPWLPDICLVQCARGNRPNSTNCIIFEINKFLIGLELVQERQLHLETNILKLEDDTNCSLSSI    141 - 210
EEDFLTASEHLEEESEVDESRNDYENINVSANVLESKQLKGATQVEWNCNKEKWLYALEDKYINKYPTPL    211 - 280
IKTERSPENLTKNTALQSLDPSAKPSQWKREAVGNGRQATHYYHSEAFKGQMEKSQALYIPKDAYFSMMD    281 - 350
KDVPSACAVAEQRSNLNPGDHEDTRNALPPRQDGEVTTGKYATNLAESVLQDAFIRLSQSQSTLPQESAV    351 - 420
SVSVGSSLLPSCYSTKDTVVSRSWNELPKIVVVQSPDGSDAAPQPGISSWPEMEVSVETSSILSGENSSR    421 - 490
QPQSALEVALACAATVIGTISSPQATERLKMEQVVSNFPPGSSGALQTQAPQGLKEPSINEYSFPSALCG    491 - 560
MTQVASAVAVCGLGEREEVTCSVAPSGSLPPAAEASEAMPPLCGLASMELGKEAIAKGLLKEAALVLTRP    561 - 630
NTYSSIGDFLDSMNRRIMETASKSQTLCSENVVRNELAHTLSNVILRHSIDEVHHKNMIIDPNDNRHSSE    631 - 700
ILDTLMESTNQLLLDVICFTFKKMSHIVRLGECPAVLSKETIRRRETEPSCQPSDPGASQAWTKATESSS    701 - 770
SSPLSNSHNTSLVINNLVDGMYSKQDKGGVRPGLFKNPTLQSQLSRSHRVPDSSTATTSSKEIYLKGIAG    771 - 840
EDTKSPHHSENECRASSEGQRSPTVSQSRSGSQEAEESIHPNTQEKYNCATSRINEVQVNLSLLGDDLLL    841 - 910
PAQSTLQTKHPDIYCITDFAEELADTVVSMATEIAAICLDNSSGKQPWFCAWKRGSEFLMTPNVPCRSLK    911 - 980
RKKESQGSGTAVRKHKPPRLSEIKRKTDEHPELKEKLMNRVVDESMNLEDVPDSVNLFANEVAAKIMNLT    981 - 1050
EFSMVDGMWQAQGYPRNRLLSGDRWSRLKASSCESIPEEDSEARAYVNSLGLMSTLSQPVSRASSVSKQS   1051 - 1120
SCESITDEFSRFMVNQMENEGRGFELLLDYYAGKNASSILNSAMQQACRKSDHLSVRPSCPSKQSSTESI   1121 - 1190
TEEFYRYMLRDIERDSRESASSRRSSQDWTAGLLSPSLRSPVCHRQSSMPDSRSPCSRLTVNVPIKANSL   1191 - 1260
DGFAQNCPQDFLSVQPVSSASSSGLCKSDSCLYRRGGTDHITNMLIHETWASSIEALMRKNKIIVDDAEE   1261 - 1330
ADTEPVSGGSPSQAEKCANRLAASRMCSGPTLLVQESLDCPRKDSVTECKQPPVSSLSKTASLTNHSPLD   1331 - 1400
SKKETSSCQDPVPINHKRRSLCSREVPLIQIETDQREACAGEPEPFLSKSSLLEEAEGHSNDKNIPDVVR   1401 - 1470
GGDTAVSACQIHSDSLDTRDVPEAEASTEARAPDEAPNPPSSSEESTGSWTQLANEEDNPDDTSSFLQLS   1471 - 1540
ERSMSNGNSSATSSLGIMDLDIYQESMPSSPMINELVEEKKILKGQSESTEAPASGPPTGTASPQRSLLV   1541 - 1610
INFDLEPECPDAELRATLQWIAASELGIPTIYFKKSQENRIEKFLDVVQLVHRKSWKVGDIFHAVVQYCK   1611 - 1680
MHEEQKDGRLSLFDWLLELG                                                     1681 - 1700
//

Text Mined References (16)

PMID Year Title