Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
25165868 Results identified HVRP1, a voltage sensing domains-containing protein primarily expressed in the central nervous system with high expression in cerebellar tissues particularly in the granule layer.
22082156 Knockdown of chromosome 15 open reading frame 27 (C15orf27) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MAVAPSFNMTNPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTAGSQLLSNLDE      1 - 70
DYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDIKLLQFSSAFQFAGVIHW     71 - 140
ISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPMVASTVANGPRSPWDAISLIIMLRIW    141 - 210
RVKRVIDAYVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAA    211 - 280
LQAPHVLSQPRSRFKVLEAGTWDEETAAESVVEELQPSQEATMKDDMNSYISQYYNGPSSDSGVPEPAVC    281 - 350
MVTTAAIDIHQPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTLGSSMDCSTAREEPSS    351 - 420
EPGPSPPPLPSQQQVEEATVQDLLSSLSEDPCPSQKALDPAPLARPSPAGSAQTSPELEHRVSLFNQKNQ    421 - 490
EGFTVFQIRPVIHFQPTVPMLEDKFRSLESKEQKLHRVPEA                                 491 - 531
//

Text Mined References (8)

PMID Year Title
25165868 2014 Evidence for functional diversity between the voltage-gated proton channel Hv1 and its closest related protein HVRP1.
22020278 2011 Aspartate?112 is the selectivity filter of the human voltage-gated proton channel.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.