Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.4e-08

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.655 2.4e-08

Synonym

Accession Q2M3A8 Q6TF48 Q8N7R8 Q8N9X7
Symbols HSD-40
C11orf36

 Compartment GO Term (0)

AA Sequence

MDLASEITSATQTSSLCSSGRGHAGYPAPGIVAHGFETHGTARVAQGHLLPPCLLPPPQMPVLAALRDLS      1 - 70
RRGSTSSSRSPSRPVSTSASKPCLPASCLGETWSISINLVGSSGHLQSPGAQRDAQRETGCLGPSWLPHH     71 - 140
QGRDEELSLSHSAQGEEF                                                        141 - 158
//

Text Mined References (4)

PMID Year Title