Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.05
PubTator Score 3.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia 2.100 4.6e-02
acute quadriplegic myopathy 1.095 2.7e-05
adrenocortical carcinoma 1.169 8.6e-04
adult high grade glioma 1.400 7.0e-03
astrocytic glioma 1.300 1.9e-03
Astrocytoma, Pilocytic 1.100 4.2e-03
atypical teratoid / rhabdoid tumor 1.400 1.2e-03
glioblastoma 1.400 8.1e-03
juvenile dermatomyositis 1.334 8.5e-10
medulloblastoma, large-cell 1.200 1.6e-03
ovarian cancer -1.600 1.0e-07
primitive neuroectodermal tumor 1.300 1.4e-03
progressive supranuclear palsy -1.100 1.6e-02
psoriasis 1.200 3.8e-05
subependymal giant cell astrocytoma 2.254 3.9e-02
ulcerative colitis 1.200 6.2e-06

Gene RIF (3)

AA Sequence

MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFNLDPIALKLLP      1 - 70
YEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYGEGATDASMVEGDCQIQMGRF     71 - 140
ISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIETTGVHFQTMYEHLGELLTVLLTLDEIIDNH    141 - 210
ITLKDHWTMYKRLLKSVHHNPSKFGIQEEKLKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSK    211 - 280
NSTFAEEFAHSIRSIFANVEAKLGEPSEIDQRDKYVGICGLFVLHFQIFRTIDKKFYKSLLDICKKVPAI    281 - 350
TLTANIIWFPDNFLIQKIPAAAKLLDRKSLQAIKIHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESIL    351 - 420
SKEQRMDKFAEDLTNRCNVFIQGFLYAYSISTIIKTTMNLYMSMQKPMTKTSVKALCRLVELLKAIEHMF    421 - 490
YRRSMVVADSVSHITQHLQHQALHSISVAKKRVISDKKYSEQRLDVLSALVLAENTLNGPSTKQRRLIVS    491 - 560
LALSVGTQMKTFKDEELFPLQVVMKKLDLISELRERVQTQCDCCFLYWHRAVFPIYLDDVYENAVDAARL    561 - 630
HYMFSALRDCVPAMMHARHLESYEILLDCYDKEIMEILNEHLLDKLCKEIEKDLRLSVHTHLKLDDRNPF    631 - 700
KVGMKDLALFFSLNPIRFFNRFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAH    701 - 770
LPSQTLEQGLDVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVN    771 - 840
FTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLGVTPEGQSYLD    841 - 910
QFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDIVNFEELVKEEGLAEETLKAARHLDSVLSDH    911 - 980
TRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPLTLNFVEHSISCKEKLNKKNKIGAAFTDDGF    981 - 1050
AMGVAYILKLLDQYREFDSLHWFQSVREKYLKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDVYLQEF   1051 - 1120
ELLYFSLSSARIFFRADKTAAEENQEKKEKEEETKTSNGDLSDSTVSADPVVK                    1121 - 1173
//

Text Mined References (16)

PMID Year Title