Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.38
PubTator Score 88.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Liver Neoplasms, Experimental 48
Disease Target Count P-value
lung carcinoma 2844 3.4217124000772E-15
Duchenne muscular dystrophy 602 5.85699846203954E-10
juvenile dermatomyositis 1189 5.86823651001268E-9
non-small cell lung cancer 2798 3.96729486522759E-8
ovarian cancer 8492 5.93802408511536E-7
chronic lymphosyte leukemia 232 1.15640686496093E-6
psoriasis 6685 8.64707288052673E-6
ulcerative colitis 2087 1.07578122520265E-5
limb girdle muscular dystrophy 2A 156 1.54032026747125E-5
primary Sjogren syndrome 789 7.6657005686249E-5
pilocytic astrocytoma 3086 1.76965036759768E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 6.52555210433E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.64606249954515E-4
tuberculosis 1563 7.20852830631712E-4
osteosarcoma 7933 7.43055375658456E-4
sonic hedgehog group medulloblastoma 1482 8.80461656200538E-4
Becker muscular dystrophy 187 9.42199442483273E-4
interstitial cystitis 2299 9.65325645663911E-4
adrenocortical carcinoma 1427 0.00279346565679723
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00344062494164272
head and neck cancer 270 0.0122564094525416
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0129237996808619
diabetes mellitus 1663 0.0147169696736842
invasive ductal carcinoma 2950 0.021468972936224
head and neck cancer and chronic obstructive pulmonary disease 237 0.0250972365201081
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0275245078508257

Expression

Synonym

Accession Q2M385 Q2M1T6 Q8TEF8 Macrophage gene 1 protein
Symbols MPG1
MPS1
Mpg-1

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26418746 Collectively, these studies further underscore the biological significance of Perforin-2 and elucidate critical molecular events that culminate in Perforin-2-dependent killing of both intracellular and extracellular, cell-adherent bacteria.
26307549 the impact of Perforin-2/macrophage-expressed protein 1 from the earliest multicellular organisms to modern vertebrates, as well as review the development of other membrane attack complexes of complement and Perforin domain member proteins
23898208 HIV-1 Tat downregulates the expression of macrophage expressed 1 (MPEG1) in human primary T cells
23753625 Knockdown of perforin-2 in macrophages did not alter the invasion of host cells but did result in chlamydial growth that closely mirrored that detected in HeLa cells.

AA Sequence

MNNFRATILFWAAAAWAKSGKPSGEMDEVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNC      1 - 70
RTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFSKVNGKFSTEFQRMKTLQ     71 - 140
VKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLENNQTRMATYLAELLVLNYGTHVTTSVD    141 - 210
AGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGG    211 - 280
VPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGC    281 - 350
TDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVH    351 - 420
LLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINP    421 - 490
MTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSLKKCPGG    491 - 560
FSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPPLMSQAATNTVIVTNSENARSWIKDSQTHQW    561 - 630
RLGEPIELRRAMNVIHGDGGGLSGGAAAGVTVGVTTILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGT    631 - 700
AATGDTTYQEQGQSPA                                                          701 - 716
//

Text Mined References (9)

PMID Year Title
26418746 2015 Enteric pathogens deploy cell cycle inhibiting factors to block the bactericidal activity of Perforin-2.
26307549 2015 Perforin-2/Mpeg1 and other pore-forming proteins throughout evolution.
23753625 2013 Perforin-2 restricts growth of Chlamydia trachomatis in macrophages.
23257510 2013 Inhibition of intracellular bacterial replication in fibroblasts is dependent on the perforin-like protein (perforin-2) encoded by macrophage-expressed gene 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7888681 1995 Isolation of a novel macrophage-specific gene by differential cDNA analysis.