Property Summary

NCBI Gene PubMed Count 8
Grant Count 120
R01 Count 93
Funding $15,800,833.79
PubMed Score 32.38
PubTator Score 88.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q2M385 Q2M1T6 Q8TEF8 Macrophage gene 1 protein
Symbols MPG1
MPS1
Mpg-1

Gene

Gene RIF (4)

PMID Text
26418746 Collectively, these studies further underscore the biological significance of Perforin-2 and elucidate critical molecular events that culminate in Perforin-2-dependent killing of both intracellular and extracellular, cell-adherent bacteria.
26307549 the impact of Perforin-2/macrophage-expressed protein 1 from the earliest multicellular organisms to modern vertebrates, as well as review the development of other membrane attack complexes of complement and Perforin domain member proteins
23898208 HIV-1 Tat downregulates the expression of macrophage expressed 1 (MPEG1) in human primary T cells
23753625 Knockdown of perforin-2 in macrophages did not alter the invasion of host cells but did result in chlamydial growth that closely mirrored that detected in HeLa cells.

AA Sequence

MNNFRATILFWAAAAWAKSGKPSGEMDEVGVQKCKNALKLPVLEVLPGGGWDNLRNVDMGRVMELTYSNC      1 - 70
RTTEDGQYIIPDEIFTIPQKQSNLEMNSEILESWANYQSSTSYSINTELSLFSKVNGKFSTEFQRMKTLQ     71 - 140
VKDQAITTRVQVRNLVYTVKINPTLELSSGFRKELLDISDRLENNQTRMATYLAELLVLNYGTHVTTSVD    141 - 210
AGAALIQEDHLRASFLQDSQSSRSAVTASAGLAFQNTVNFKFEENYTSQNVLTKSYLSNRTNSRVQSIGG    211 - 280
VPFYPGITLQAWQQGITNHLVAIDRSGLPLHFFINPNMLPDLPGPLVKKVSKTVETAVKRYYTFNTYPGC    281 - 350
TDLNSPNFNFQANTDDGSCEGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVH    351 - 420
LLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINP    421 - 490
MTNAQSCPAGYFPLRLFENLKVCVSQDYELGSRFAVPFGGFFSCTVGNPLVDPAISRDLGAPSLKKCPGG    491 - 560
FSQHPALISDGCQVSYCVKSGLFTGGSLPPARLPPFTRPPLMSQAATNTVIVTNSENARSWIKDSQTHQW    561 - 630
RLGEPIELRRAMNVIHGDGGGLSGGAAAGVTVGVTTILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGT    631 - 700
AATGDTTYQEQGQSPA                                                          701 - 716
//

Text Mined References (9)

PMID Year Title
26418746 2015 Enteric pathogens deploy cell cycle inhibiting factors to block the bactericidal activity of Perforin-2.
26307549 2015 Perforin-2/Mpeg1 and other pore-forming proteins throughout evolution.
23753625 2013 Perforin-2 restricts growth of Chlamydia trachomatis in macrophages.
23257510 2013 Inhibition of intracellular bacterial replication in fibroblasts is dependent on the perforin-like protein (perforin-2) encoded by macrophage-expressed gene 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7888681 1995 Isolation of a novel macrophage-specific gene by differential cDNA analysis.