Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 9.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (2)

PMID Text
25558830 Kiz phosphorylation depends on a balance between CDC25B and Plk1 activities.
24680887 Immunohistology revealed KIZ localization at the basal body of the cilia in human fibroblasts, thus shedding light on another ciliary protein implicated in autosomal-recessive RCD

AA Sequence

MSRTLASAVPLSSPDYYERLGQLQHGLRDSEKKRLDLEKKLYEYNQSDTCRVKLKYVKLKNYLKEICESE      1 - 70
KKAHTRNQEYLKRFERVQAHVVHFTTNTEKLQKLKLEYETQIKKMLCSKDSLGLKEELTDEDREKVAVHE     71 - 140
GINSGTAMSRGLYQPATIFMGRQMSAILSMRDFSTEHKSPQPTKNFSIPDPHSHRQTAQSSNVTDSCVVQ    141 - 210
TSNDTQCLNKSDNIDGKASLQIGEKMPVTASVLSEEEQTHCLEIGSNTRHGKSNLSEGKKSAELNSPLRE    211 - 280
RLSPENRTTDLKCDSSSGSEGEILTREHIEVEEKRASPPVSPIPVSEYCESENKWSQEKHSPWEGVSDHL    281 - 350
AHREPKSQKPFRKMQEEEEESWSTSSDLTISISEDDLILESPEPQPNPGGKMEGEDGIEALKLIHAEQER    351 - 420
VALSTEKNCILQTLSSPDSEKESSTNAPTREPGQTPDSDVPRAQVGQHVATLKEHDNSVKEEATALLRKA    421 - 490
LTEECGRRSAIHSSESSCSLPSILNDNSGIKEAKPAVWLNSVPTREQEVSSGCGDKSKKENVAADIPITE    491 - 560
TEAYQLLKKATLQDNTNQTENRFQKTDASVSHLSGLNIGSGAFETKTANKIASEASFSSSEGSPLSRHEN    561 - 630
KKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD                               631 - 673
//

Text Mined References (12)

PMID Year Title
25558830 2014 Kizuna is a novel mitotic substrate for CDC25B phosphatase.
25416956 2014 A proteome-scale map of the human interactome network.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24680887 2014 Whole-exome sequencing identifies KIZ as a ciliary gene associated with autosomal-recessive rod-cone dystrophy.
19536135 2009 Cep72 regulates the localization of key centrosomal proteins and proper bipolar spindle formation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16980960 2006 The Plk1 target Kizuna stabilizes mitotic centrosomes to ensure spindle bipolarity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...