Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 9.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
juvenile dermatomyositis 1189 7.94205181764674E-12
ovarian cancer 8492 3.48378099875475E-8
acute quadriplegic myopathy 1157 1.07145415556748E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00197472107823752
astrocytic glioma 2241 0.00550521921681768
oligodendroglioma 2849 0.0107364472142495
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0116899462281861
ependymoma 2514 0.0207367286877408

Expression

  Differential Expression (8)

Synonym

Accession Q2M2Z5 B4DDE9 B4DK54 Q4G0M8 Q4G0S5 Q5BKY3 Q6P0M6 Q71ME0 Q9NZ35
Symbols RP69
HT013
Kizuna
PLK1S1
C20orf19
NCRNA00153

Gene

KIZ

  Ortholog (3)

Species Source
Mouse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
25558830 Kiz phosphorylation depends on a balance between CDC25B and Plk1 activities.
24680887 Immunohistology revealed KIZ localization at the basal body of the cilia in human fibroblasts, thus shedding light on another ciliary protein implicated in autosomal-recessive RCD

AA Sequence

MSRTLASAVPLSSPDYYERLGQLQHGLRDSEKKRLDLEKKLYEYNQSDTCRVKLKYVKLKNYLKEICESE      1 - 70
KKAHTRNQEYLKRFERVQAHVVHFTTNTEKLQKLKLEYETQIKKMLCSKDSLGLKEELTDEDREKVAVHE     71 - 140
GINSGTAMSRGLYQPATIFMGRQMSAILSMRDFSTEHKSPQPTKNFSIPDPHSHRQTAQSSNVTDSCVVQ    141 - 210
TSNDTQCLNKSDNIDGKASLQIGEKMPVTASVLSEEEQTHCLEIGSNTRHGKSNLSEGKKSAELNSPLRE    211 - 280
RLSPENRTTDLKCDSSSGSEGEILTREHIEVEEKRASPPVSPIPVSEYCESENKWSQEKHSPWEGVSDHL    281 - 350
AHREPKSQKPFRKMQEEEEESWSTSSDLTISISEDDLILESPEPQPNPGGKMEGEDGIEALKLIHAEQER    351 - 420
VALSTEKNCILQTLSSPDSEKESSTNAPTREPGQTPDSDVPRAQVGQHVATLKEHDNSVKEEATALLRKA    421 - 490
LTEECGRRSAIHSSESSCSLPSILNDNSGIKEAKPAVWLNSVPTREQEVSSGCGDKSKKENVAADIPITE    491 - 560
TEAYQLLKKATLQDNTNQTENRFQKTDASVSHLSGLNIGSGAFETKTANKIASEASFSSSEGSPLSRHEN    561 - 630
KKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD                               631 - 673
//

Text Mined References (12)

PMID Year Title
25558830 2014 Kizuna is a novel mitotic substrate for CDC25B phosphatase.
25416956 2014 A proteome-scale map of the human interactome network.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24680887 2014 Whole-exome sequencing identifies KIZ as a ciliary gene associated with autosomal-recessive rod-cone dystrophy.
19536135 2009 Cep72 regulates the localization of key centrosomal proteins and proper bipolar spindle formation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16980960 2006 The Plk1 target Kizuna stabilizes mitotic centrosomes to ensure spindle bipolarity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...