Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 9.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.006 1.8e-04
astrocytic glioma 1.400 5.5e-03
ependymoma 1.300 2.1e-02
intraductal papillary-mucinous carcinoma... 1.200 1.2e-02
intraductal papillary-mucinous neoplasm ... -1.200 2.0e-03
juvenile dermatomyositis 1.438 7.9e-12
oligodendroglioma 1.700 1.1e-02
ovarian cancer -1.800 2.9e-08

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

AA Sequence

MSRTLASAVPLSSPDYYERLGQLQHGLRDSEKKRLDLEKKLYEYNQSDTCRVKLKYVKLKNYLKEICESE      1 - 70
KKAHTRNQEYLKRFERVQAHVVHFTTNTEKLQKLKLEYETQIKKMLCSKDSLGLKEELTDEDREKVAVHE     71 - 140
GINSGTAMSRGLYQPATIFMGRQMSAILSMRDFSTEHKSPQPTKNFSIPDPHSHRQTAQSSNVTDSCVVQ    141 - 210
TSNDTQCLNKSDNIDGKASLQIGEKMPVTASVLSEEEQTHCLEIGSNTRHGKSNLSEGKKSAELNSPLRE    211 - 280
RLSPENRTTDLKCDSSSGSEGEILTREHIEVEEKRASPPVSPIPVSEYCESENKWSQEKHSPWEGVSDHL    281 - 350
AHREPKSQKPFRKMQEEEEESWSTSSDLTISISEDDLILESPEPQPNPGGKMEGEDGIEALKLIHAEQER    351 - 420
VALSTEKNCILQTLSSPDSEKESSTNAPTREPGQTPDSDVPRAQVGQHVATLKEHDNSVKEEATALLRKA    421 - 490
LTEECGRRSAIHSSESSCSLPSILNDNSGIKEAKPAVWLNSVPTREQEVSSGCGDKSKKENVAADIPITE    491 - 560
TEAYQLLKKATLQDNTNQTENRFQKTDASVSHLSGLNIGSGAFETKTANKIASEASFSSSEGSPLSRHEN    561 - 630
KKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD                               631 - 673
//

Text Mined References (12)

PMID Year Title