Property Summary

Ligand Count 4
NCBI Gene PubMed Count 30
PubMed Score 18.82
PubTator Score 16.54

Knowledge Summary

Patent (3,434)

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.400 1.3e-05
astrocytic glioma -3.200 1.2e-03
Astrocytoma, Pilocytic -4.500 8.1e-14
atypical teratoid / rhabdoid tumor -1.600 7.7e-07
Breast cancer 2.500 2.6e-02
ependymoma -4.100 5.0e-04
glioblastoma -4.000 3.5e-12
group 3 medulloblastoma -1.400 3.9e-04
lung cancer -1.100 1.1e-03
medulloblastoma, large-cell -2.100 1.8e-05
oligodendroglioma -3.100 1.2e-02
osteosarcoma 3.701 3.5e-10
ovarian cancer 1.700 1.3e-05
pancreatic ductal adenocarcinoma liver m... 1.116 2.8e-02
Pick disease -1.400 3.2e-02
primitive neuroectodermal tumor -2.600 4.2e-03
progressive supranuclear palsy 1.300 5.4e-03
psoriasis 3.800 3.3e-06
subependymal giant cell astrocytoma -3.365 4.1e-02

Gene RIF (9)

AA Sequence

MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMK      1 - 70
CALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQ     71 - 140
RLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQTEGV    141 - 210
NAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNS    211 - 280
RYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPK    281 - 350
ARLTDPIPTTETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP    351 - 420
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPPAQQQPAGTFY    421 - 490
QQQQAQTQQFQAVHPATQKPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQQQQQQQLATALHQQQLMTQQ    491 - 560
AALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQPKVQTTPPPAVQGQKVGSLTPPSSPKTQRA    561 - 630
GHRRILSDVTHSAVFGVPASKSTQLLQAAAAEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDD    631 - 700
DNFSKLTAEELLNKDFAKLGEGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGL    701 - 770
PLLSVSDPFIPLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV    771 - 840
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNLISGFDVPEGS    841 - 910
DKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLIDL                       911 - 961
//

Text Mined References (45)

PMID Year Title